KEGG   Clavispora lusitaniae: CLUG_03947Help
Entry
CLUG_03947        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
clu  Clavispora lusitaniae
Pathway
Cell cycle - yeast
Meiosis - yeast
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    CLUG_03947
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    CLUG_03947
   04113 Meiosis - yeast
    CLUG_03947
Protein phosphatases and associated proteins [BR:clu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     CLUG_03947
Ubiquitin system [BR:clu04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     CLUG_03947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 654 aa AA seqDB search
MEPDPLYVIQQLRSIVIHSLDTFNFKNAEFACERLLAAAPEDPDSVYLYALTLYRQGKYK
AVYNHTLEEGDIEHLGCAYIFARSCLHLQRYKEGVFRLVSVAHLYNENRLREHESEHENG
IFDDKSGQQPPFFFSLSMQRHNYEVSRSIYPDASAIYHLLGDLCKAQGDLKNSALNYQEA
LRFNAFDFEAFQELSRMGVKVAVKSLYKAPTQRFSVNGPLLSSLGNQEDLFSKPDIPAVP
NPFATTPRQHTLADVSTPRAPDPLSRRPTGEIEPLRPAIGPRTRSRSFSYTKKPDLAHPD
NRGLKRAIQSERPYVEPVVGVSKEVDSADAFLRRLYMLFAKSFKCFSKYDCYKAIRILES
LPENERDTPWVLSKLGRLHYEIVNYKQSEKFFIRLRQLDRTRLEDMEFYSTLLWHLHKKT
ELVYLANELHDIDSKSAITWCVMGNMFSLNREPDEAIKCFNKSIALDSSFTYAHTLKGHE
YFGADNYERALDCFRFSLLLDPRHYNAFYGIGMVYINLGEYHKADYHFRNAVAINPINII
LICCVGMVLEKLGKKTLALRQYELANRLQPLSALPIFKKAQLLFSMQQFPQALKQFELVK
DLAPNEASVHFLLGQLYNIQNDRFSAIREFTIALNLDPKGNYLIREAMEMLKKE
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggagcctgacccactctatgtaattcagcagctccgatccattgtgatccattcgctt
gacacattcaacttcaagaatgctgagtttgcatgtgaacggctactcgccgcagcgcct
gaagatccagattcagtatatttatatgcgctaactctctatcggcaagggaagtacaaa
gcagtgtacaatcacacgttagaagaaggagacattgaacacttgggctgtgcttacatc
ttcgcccggctgtgcttgcatttgcagcgctacaaagaaggtgtctttcgcttagtcagt
gttgcccatttgtacaacgaaaaccgcctcagagagcatgagagcgaacacgaaaacggt
atatttgatgacaaactgggccagcagccgccttttttcttcctgctttcgatgcaacga
cacaactacgaagtttctcggctgatttatcctgacgcgtcagccatctaccatcttttg
ggtgatttgtgcaaagctcaaggtgatctcaaaaatagtgcacttaattaccaagaagct
cttcgattcaacgcttttgatttcgaggcgttccaggaacttctgcgtatgggcgtgaaa
gtggcagtcaaatctctatacaaagcaccaacccaacgtttttctgtaaacggacctcta
ctactgtcattagggaatcaagaagatcttttctccaaaccggacattccggcagtgcct
aatccctttgccactacgccgcggcaacatactttggctgatgtttcaacacctcgtgct
ccagatccgctttctcgccgtccaacaggcgagattgaaccacttcgaccggccatagga
ccccgcactcgctcgcgcctgttttcgtacactaagaagcctgacttagcacatcctgat
aatcggggcctcaaacgtgccatccaatcagaacggccatatgtggaacccgtggttggt
gtatccaaagaagtggattctgctgatgcttttttgcgccgcctctacatgttgttcgcg
aagctgtttaaatgtttcagcaaatatgactgttacaaggcaattcgtattcttgagtcg
cttccagagaacgagcgtgatacgccatgggtgctttccaagcttggccgcttacattac
gaaattgttaattataaacagtcggagaagttttttattcgtttgcgccaacttgatcgc
acccgactcgaggatatggagttttactccactttactctggcacctccacaagaaaacc
gaacttgtgtacttggccaatgagctccatgatattgactcgaaactggcaatcacctgg
tgtgttatgggcaacatgttttccctcaatcgcgagcctgacgaagccatcaaatgcttc
aataagtctattgctttagactcttctttcacgtatgcacatacacttaagggtcatgag
tatttcggagctgacaattatgaacgagcattggactgtttccgtttttcgcttttactt
gatccacgtcactacaacgcattttacggtatcggaatggtatacattaatttgggagaa
tatcacaaggcagattatcacttccgtaatgctgttgcaataaatccaatcaatataatc
ctcatttgctgtgtgggtatggtactagaaaaattgggtaagaaaacattagccttgcgt
caatacgagcttgccaaccgacttcaaccattgagtgcgttgcccatatttaaaaaggca
caactactcttttccatgcaacagtttccccaagcactcaaacagttcgagcttgtcaag
gacttggcaccaaatgaagcttcggtgcattttcttttggggcagctctacaacattcaa
aacgatcgtttcctggctatacgggaattcactattgcgcttaatttagatcccaaagga
aattacctaatccgagaagctatggagatgttaaaaaaagagtga

DBGET integrated database retrieval system