KEGG   Clavispora lusitaniae: CLUG_03983Help
Entry
CLUG_03983        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
clu  Clavispora lusitaniae
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CLUG_03983
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1869 aa AA seqDB search
MASDLLNWNPQAFESCYNAIKFSASVPQSLDSSIGPDLRALLTVPSKNEKSRSTLAAGET
GKPVVLLNGDEYKFNKPFLAATSSLSVELDLDELACAELLEVASSALGKEFDLVDAGRLA
FIQRYEYILNIAGHLVTTAKLSTIIKQNQASTMLSSIIASFKKIYSLLQIQNDLIDKQKA
TGDLNDVQFVDKIVFMKNKLFSIHGLLAQVLFSIVDKYISELGNFESYSSIVSHINESVK
DDSDILLLHYLPSLMRIISSLSDLPDDQVSKLHSNFVSALSSDYSKVNSGEIINLENSSI
RSYVLVLQLFFFIAMIPWCKDEETRTKKYDFEKDILKYVEWLISYGTLEQLLCYAAESAT
PETKVLYERRSLYDFRPLLQRNFPSLKPVKLIYSGNEELSHIAKSRPELTNMAILCDYSS
FEISNEFSNQLLAPFFHSFFSDFINHAAIVLSSLRDSEEDFLLSSMNRKQLESASDDAES
KTEEDINTAELSKRSNDHDSKTDGNSLDLESIASRGELDRFYLAFAFTYTHRPDLCNAFW
TGDEANIAGFINWGLANNTSPLITATFCLLLASLTSAGEIVSAKVWEFLINAQGGSIKRN
DYSKVSVDSILHSLTYYVDSLTENLEHDLNLQTKQQQRKSDILFSNPYTNKKDNELKKSV
SIQLSEDSVIFISGFLMLISAIVKNANKNSPLSRSLRQSAFNCFLPVIIGFLKFDNLIIS
AKSAPTDDKVIPVVFNDENRTIIINLILNLLADFAENEQNLDLRFKIWNTLDRWICHSLH
DLDTNNSAPSDTTRYAGVSLSTTSLSSGKNELSKLRTLHRGINMKSGLQMSLNNISEVIN
FVLLLKNLLTPLESGKKASSSIQLLYPSNLGFGHRHKNQIGVWPYIEYLIVEVFAKTPKL
KQKEHKLILQDSIIFIIQSALGEVDWPFVNNVAPHILLDLPREREAFAQSQLVSDEPATL
SYTSFVKLHHSVAVLNYMFDENASKALLDIINIGAETINLISSQKFLVKGALEALNSILA
LQDTFIEGLLPILKNTDNGSPPSTAVGYGTSLSLALAAPKTVFDNIYYPSNLGTKGVSSY
YEILLFHIPSIVNIALYVGSSDLEIADSALEIIRKLSLCSLFVSKSNNIQFLRRNRLLDI
FNSIDESFKIQYGFTQQIATITDQLSIKFKILKYLLSNMNGINEVSVSHFLLGFDIKDSQ
LVLDQEREADTLLSSLVELLISTLNMISEVDYSQGYSHHIGLGPAKLTSMIMEIFVRLCQ
DPISSTTTLNFLRKYDLFAKLLSAQLIIDDMTTWENYKFNGVASQGSENAFLFNESSCET
FFSFIKYRNAVLQYLSTEFHATNSLYRKEYYVSLLLDGSEFLDGTPKILNFLDLLNFRFC
NFDDHKLEQFNGKYNMRYLLMESVKDKEEGNQDSVIKKLVKLSCQVASHKFPTEDSKAAF
VNEITTDFSHIEDFLVKFNNVSQLKTLQLKSLHSWVQFIQVVTYEGVINKTDFIFNVFQI
ILPKVNNEYYERDISLAEELISLCVFLFELYEQENKLNLGEENSHYLQRLLPLFKTCVSG
VLCLNSTATLRSDLYLLLNKCIQRSIKAETSLRQIVEILRSIDKKFIDIVCNDSIYSEGT
PRITSLVFMESLIHLSCMEKSTTILEALTRNNSLSLLVRSLKRTDEIIVACDVNGDEKQN
SGINIDTLLYELTALKSTLYLLIRIAQTRQGAAQLFQHEIFSVIKQLKFLAIDADLGIDL
IIDCSEDISQHKHENARIKLSLDVPVALGQNSHVRDEGRLVSYYEFLVPTFQLIATMLLS
MGSSYKPGVEQVKELMKHFHRFIVGVMKRDALLEDGQAPETYEDISYVGLQEIVRLLSLI
DAVIEDDQV
NT seq 5610 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgacttgctaaattggaatccgcaggcattcgaatcttgctacaatgccata
aagttcctggcatctgtgccgcaactgcttgattcctccatcggtccagatttacgggcg
cttcttaccgttccatcgaaaaacgaaaagagtagatcgacactagctgctggcgaaact
gggaaacccgttgtcttgctcaatggcgatgagtacaaattcaataaaccctttcttgcc
gccacaagctccttgtccgttgaacttgatttggatgaattggcgtgcgcagagcttctt
gaagtcgctagctctgccctaggaaaggagtttgaccttgtggacgcaggtcgtttggct
tttattcaacgctatgagtacatcttgaatattgctggccacttggtgaccacagcgaag
ttgtctactatcataaaacaaaaccaggcctctacaatgctttcatcgattattgctagt
tttaagaaaatctacagcttacttcaaatccagaacgatctcattgataaacaaaaggct
acgggcgatctcaatgatgttcagtttgttgataagattgttttcatgaaaaataaactt
tttctgatccatggtcttttggcgcaggtgttattctccatagtggacaagtatattctg
gagcttggaaacttcgagtcatactcatcgatcgtgtctcatatcaatgagtcagtaaaa
gatgattctgatattcttctattgcattacctcccttccttgatgagaattatcagctca
ttatcggaccttcctgatgaccaggtctctaaattgcatctgaattttgtatctgctctt
tcctcggactattccaaagtcaatagtggagagattatcaacttggaaaactcgtctatc
cgctcatatgttttggtcctccagctttttttcttcattgcaatgattccttggtgcaaa
gacgaagaaacccgcacaaaaaagtatgattttgagaaagatattttgaaatatgtcgaa
tggcttataagctatggaacgctcgagcaacttctttgttacgcggcagagtcagcaaca
ccagagacaaaggttttatatgagagaagaagtctctacgattttagaccattgcttcaa
agaaactttccgagcttgaaacccgtgaagttgatttactcaggaaatgaagagttatcg
catatcgcgaaatcacggcctgaacttaccaacatggccatcctttgtgattacctgtca
ttcgagatttccaatgagttctccaatcaactattagcaccttttttccacagctttttc
agcgatttcatcaaccatgcagcgattgtccttagtctgcttcgtgacagcgaagaagat
ttccttttgtcatctatgaataggaaacagcttgagctggcttcagatgacgcggaatca
aaaacggaagaagacattaatacagcagaattaagcaaaagaagcaacgatcacgacagc
aaaactgatggaaatagccttgatcttgaatctatcgcaagtcgaggggagttagatcgt
ttctatttagcgttcgcattcacctatacacatagaccagacttatgcaatgcattttgg
actggagatgaagctaacatagccggttttattaattgggggttggcaaataacacctct
cctttgatcactgccacgttttgtcttttattggcaagtttgacttctgcaggagaaatt
gttagtgccaaggtgtgggaattcttgattaacgctcaaggaggaagtatcaaacgtaat
gattactccaaggtttctgtggattccatattgcattccttaacttattacgtggattca
ttaacggaaaatttagaacatgatttgaaccttcaaacgaagcaacagcaaaggaaactg
gatatcttattttcaaacccatacacaaacaaaaaagacaatgaacttaagaagtcagtg
tcaattcagttatcagaggattctgttattttcatatctggttttttgatgcttatttca
gccattgtaaagaatgcgaacaaaaattcacctttatcaagaagtttgagacaatcagca
tttaattgttttcttcctgtcatcattggattcctcaaatttgataatttgattatttca
gcaaagtcggcacctactgatgacaaggtcataccagtggtatttaacgatgagaatagg
accataatcatcaatttaatactcaacttgttggcagatttcgcagagaatgaacagaat
ttggatcttcgcttcaaaatatggaatactttagatcgctggatatgtcacagtcttcat
gacttagacacaaataattcagcaccctctgatactactagatacgctggtgtatctcta
tctactacatcattaagctcaggaaaaaatgagctttcaaagttgagaactcttcaccgc
ggaatcaacatgaagagtggtttacagatgagtctaaacaacatctctgaagttattaac
tttgttcttcttttgaagaacttacttacgccattggaaagtggtaaaaaagccctgtct
tctattcaactattatatccatcaaacttgggattcgggcaccgccacaagaaccagatt
ggtgtatggccttatatcgaatacttgatcgtggaagttttcgccaagacgcccaaactt
aaacaaaaggagcacaagttgattttgcaggactcaattatcttcatcatccaatcagct
ttaggcgaggtggattggccgtttgtaaataacgttgcaccacacattttactcgatttg
ccccgtgaaagagaggcatttgcgcagctgcaacttgtttcagacgaacctgcaacattg
tcatacacaagttttgtcaaactacaccactctgttgccgttttaaactatatgtttgat
gagaatgcctccaaagcgttactagacattattaatataggggccgagactataaatttg
atatcctcccaaaagtttttggtgaagggtgcattggaagctttaaattccatattggct
cttcaggatactttcatcgaaggattgcttccaattttgaagaacactgataatggttca
ccaccatctacggctgtgggatacggaacaagcttaagtttagctttggctgctccaaaa
actgttttcgataacatctactacccatcgaatttgggtacaaaaggcgtatcgtcttat
tatgaaatccttttgttccatattccaagcattgttaacattgctttgtatgtgggtagc
tcagaccttgaaattgccgatagcgcgttggaaatcataaggaagttgtcactttgttct
ttattcgtgtcgaaatccaacaacatacaattcttgcgaaggaacaggttattggacatc
ttcaatagcattgacgagtcctttaaaatacagtatggatttacgcagcaaattgctacc
atcacggatcagttgagtatcaagttcaagatattaaaatacttgttatcaaacatgaat
ggaatcaatgaagtttctgtatctcatttccttcttggatttgatataaaggacagccaa
ctcgtgcttgatcaagagagagaagctgacacattacttctgagcctagtggaattgttg
atctcgaccttgaatatgatctcagaagtcgattacagtcaaggatacagccatcatatc
ggtcttgggccagctaaacttacttccatgataatggagatttttgtgagattgtgccaa
gacccaatttcatcaactacgacgttgaattttttgcgcaagtatgatttgtttgcgaaa
ttgctttcagctcaactaataatcgatgacatgacaacgtgggagaactacaaattcaat
ggtgttgccctgcaggggtctgaaaatgcgtttttgttcaatgaaagtagttgtgagacg
ttcttcagctttatcaaatatagaaatgctgtgctccaatacttatctacagagtttcat
gctacgaactccctttacaggaaggagtattatgttagccttttactcgatggatcagaa
tttcttgatggcacgccgaaaattttgaactttttggatctcttgaatttccgtttttgc
aactttgacgatcacaagcttgaacaatttaacggaaaatataatatgcggtatctatta
atggaatccgtaaaagataaagaggaaggaaatcaggacctggtgattaaaaagttagtt
aagcttagttgtcaggtagcctcacacaagttcccaactgaagattcgaaggcagcgttt
gtgaatgagataactacggatttcagccacattgaagactttttagttaagttcaataat
gttagccaattaaagactttgcaattaaagtctttacattcgtgggttcagtttattcaa
gtcgtgacatatgagggtgtgataaacaagacggactttatcttcaatgtcttccaaatt
attcttcccaaggtcaacaacgaatactatgaaagagatattctgcttgcagaagagtta
atttctctttgtgttttcctctttgagttgtacgaacaagagaacaaacttaatttggga
gaggagaactcgcattacttacaaaggcttctccctttattcaagacttgtgttagtggg
gtgttgtgcttaaattctactgccacgttgcgctctgatttatatcttttgctcaacaaa
tgcattcaaagaagtatcaaggccgaaacttcccttcgtcaaattgtggaaattttacgc
tctattgataaaaaattcattgatattgtttgcaatgattcgatctactctgaaggaact
cctcgtatcacctcgctagtgttcatggagtctttgattcatttgtcatgcatggaaaag
tctaccaccattcttgaagcattaaccagaaacaattcgttgtcattgctcgtgagatct
ttgaagagaactgatgagataattgtggcttgcgatgttaatggagacgaaaagcagaat
tctggaatcaatattgacacgcttctttacgagctcacggcactcaaatccacattatac
cttttaataagaatagcccaaacgagacaaggtgcagcacagttatttcagcatgagata
ttctctgtgatcaaacaactcaagtttttggccatcgatgccgatttgggaattgacttg
atcattgactgcagtgaggatatcagtcaacacaaacacgaaaatgcaagaatcaaactt
tcgttagatgttccggtggcacttggacagaatagccacgttcgggacgagggcagacta
gtatcttactacgagtttttagtgcccacatttcaacttattgcaacgatgctcctttcc
atgggctcttcttacaagccgggggttgaacaagtgaaagaactaatgaagcatttccat
cggtttatcgtcggagttatgaagagagatgcgttacttgaggatggccaagctccggag
acatacgaggatatatcgtacgtggggttacaggagattgtgcgtcttttgtcgcttata
gatgccgtgattgaagatgatcaagtctaa

DBGET integrated database retrieval system