KEGG   Clavispora lusitaniae: CLUG_03986Help
Entry
CLUG_03986        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
clu  Clavispora lusitaniae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CLUG_03986
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    CLUG_03986
Enzymes [BR:clu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CLUG_03986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 985 aa AA seqDB search
MIQQQLGQLVCGGFLGTTATPQAYELIVKHRVSTMILSRRNAESAEQMAHLIRDLQRIAL
EHAHYKYPLLIAIDEEGGMLNTLFDSRDLTQFPGAMALAATGDTELVYEVARATARELRH
IGFSVILGPVLDVVTKMSAQLVSVRSFGSSVEDVARYGRACARGLRDGGLITVGKHFPGI
GNATVDSLLEVPIMAESLDQLRGSNVVPFAELIQEGLLDGISAAGCGVPAIAPDEVHACL
SPVLLTQLLREELHFDGFVISECLEMDALYHSIGLGQGAVLAVCAGCDLVMCCHDFERQV
EAIDSLAKALANGMLDERIIAASMQRIETVQRRVASWAEIFSATGPFREAQPDWWRSHQQ
LSRRAYRSSITLVRDYEDTLPLTKWARYSEDENVGEQETERKENGKKEIDKSSTTNNERN
VPESILVLTPLLNPVYPRTAVRANGLHTGEEVFQRFGEALARHPANKFNVLHTTYTANGL
TALHEQLIANAKAVVVVTSEARRNMYQVGIVKYVSVLCGAPPHFPRSRARAPLAKPLVLV
ATSSPYDFFYHRSIGSAYLCCYDYTQNALDEVARVLMGDYVPQGCVPGEKKYNHSRRRRL
SVSAPAGGAPKLRRVVAPTRRWLVDEFDATRDWRALLALFKANKGAEYSEAYVRRLLMLL
HAHAATQRHFVVRNASLNVIYGIVFTWIDDVPPPDRSGKILYLLVDRAKRLQSVGRNLHA
RAVRYLCKEKGCSAVQLGSSFPLIGFQDEAHMTADPAVISFLNITGWDLGDPCASPQLHA
MVMTGLADWSVPHKIFRELTIVGVRFDICVHSEKLEGLLSRASEGAAGQPSPLRHVRYLY
KQAMARMSSSVSHEAKVIIALEPANQSVIGSIVLFTSKCSMALFYPFIDPDKEGSLVGGI
VSPVIDPSYSNLTEILRFGLICSAVTYLRSNFCDNPKSHMDKCFMMDVADDKSFEGVKDI
GFESWKEYREFYDHSNGATLMCEDQ
NT seq 2958 nt NT seq  +upstreamnt  +downstreamnt
atgatccagcaacaacttgggcagctagtatgcggtgggttcttaggcactacggccacg
ccacaggcgtacgagcttatagtcaagcatcgcgtgctgacgatgattctatcgcggcgg
aatgcagagctggccgagcaaatggcacaccttatccgcgatcttcaacgcattgcgctc
gagcatgcccactacaagtatccgctccttatagctatcgatgaagagggcggcatgctc
aacacactctttgattctcgcgatctaactcagttcccaggcgccatggctttggccgca
acgggcgacacagagctagtgtatgaagttgcccgtgccacagcacgagaactccgccac
attggcttttctgtgatattgggacctgtgcttgacgtggtaacaaaaatgtcggcacaa
cttgtgctggtacgctcctttgggtcgagcgttgaggatgtagcacgctacggcagggct
tgtgcacgggggctccgagatggtggtcttatcaccgtaggaaaacactttcccggcatc
ggaaatgcgacagttgattcattacttgaggtcccgattatggctgagtccttagaccag
cttcgaggactgaatgttgtgccttttgccgagcttattcaagaggggctcttggacggg
atatctgcagcaggttgcggtgtgcccgcaatcgccccggacgaggtgcacgcttgtttg
ctgcctgtattgctcacgcagcttctacgcgaagagctacactttgacgggtttgtcata
agcgaatgtcttgaaatggatgcactttaccatctgattggtctcggtcagggagcagtg
ttggcggtgtgcgctgggtgtgacttagttatgtgttgtcatgattttgagcggcaggtg
gaagcgatcgactcgctagcaaaagcattggccaatggaatgcttgatgaacgaatcatt
gcagcgtccatgcagcggatagaaaccgtacagcgccgtgtggcactgtgggcagagatt
tttagtgcgacagggccctttcgtgaggcgcagcccgactggtggcgctctcatcaacag
ctttctcgtcgcgcttaccgcctgtccattactctagtgcgcgactacgaagatacgctc
ccgctcacaaagtgggcgcgttattcagaagatgagaatgtgggtgagcaggaaacagag
agaaaagaaaatggaaagaaggagatcgacaaaagcagtaccactaacaatgaaagaaat
gttcccgagtcgattctcgtgcttacgccacttttgaaccctgtatatcccaggacagct
gtccgtgcgaacggtcttcatactggcgaagaagttttccagcggtttggcgaggctttg
gcgcgtcacccagcaaacaaattcaatgttttacacacaacttacacagccaacggactc
acagcacttcacgaacaactcattgcaaatgcaaaggctgtggtcgtggtgacatctgag
gcccgcaggaacatgtatcaggttggcatcgtcaaatatgtgtctgtgctctgcggagcc
ccgccccattttcctcgcctgcgagcgcgcgctccgttggccaagccgttggtgctcgtc
gcgaccctgagcccatacgatttcttttaccaccggagcattggttccgcctacttatgc
tgctatgactacacacagaatgcccttgacgaagtggcaagggtactcatgggagattat
gtaccccaaggctgtgtacctggcgagaagaagtacaaccattcgcggcggaggagacta
ctggtgtcggcaccggcaggcggcgcgccaaaacttcggcgcgttgttgcgccaacacgt
cggtggttggtggacgagtttgatgccacgcgtgattggcgcgcgcttctcgcattattc
aaggctaacaagggcgccgaatacctggaggcatatgtgcgccgactcttaatgctcttg
cacgcgcatgcggctacacagcgccactttgttgtgcgcaatgcctcactcaacgtaatc
tacggcattgtgttcacgtggatagatgacgtacctcctccggaccgtctgggtaaaata
ctttatcttttggtggatcgcgctaagcgacttcagctggttgggcgcaacttgcatgcg
cgtgcagtgcgttacctttgcaaagaaaagggctgcagcgcggtacagttgggcagctct
tttcccttaattgggtttcaggatgaagcgcacatgaccgctgacccggcagtgatatct
tttctcaatatcacagggtgggacttgggcgatccatgcgcgctgccacagctccatgcc
atggtgatgacgggtcttgcagattggtcagtcccgcacaagatattccgcgagttgacc
attgttggcgtgcgattcgatatctgcgtacatctggagaagcttgaaggtcttctctcg
cgcgcgagcgaaggtgctgcaggccagccgtctccgctccgacatgtgcgctatttgtac
aagcaagccatggcacgtatgtctagctcggtgctgcacgaggcaaaagttattattgca
ttggaaccagccaaccagagtgtgatcggaagtattgtattatttaccagcaagtgtctg
atggcactcttctaccctttcatcgacccagacaaggaaggactgcttgtgggcggcatc
gtgagtcctgtgattgatccatcctactcaaaccttacagagatattgcgctttggtctc
atctgctcagcagtaacgtacttgcgttcaaatttctgtgacaacccgaagctgcacatg
gacaagtgttttatgatggacgtggcagacgacaaatcgtttgagggggtcaaggacatt
ggctttgagctgtggaaggaataccgcgagttctacgaccatctgaatggtgcaaccctc
atgtgcgaagaccaataa

DBGET integrated database retrieval system