KEGG   Clavispora lusitaniae: CLUG_03997Help
Entry
CLUG_03997        CDS       T01149                                 

Definition
similar to MAP kinase
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
clu  Clavispora lusitaniae
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:clu00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CLUG_03997
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CLUG_03997
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CLUG_03997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 544 aa AA seqDB search
MAYNGKSVNKVFNQDFIIDKRFKIVKELGHGAYGIVCSAKYDDGMSDGQENFVAIKKITN
IFSKKILCKRSLRELKLLQFFRGHKNITCLYDLDIVPDPVTGDFNEVYLYEELMECDMHQ
IIRSGQPLTDSHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKICDFGLARG
FSEDVEQNAGFMTEYVATRWYRAPEIMLSFSNYTKAIDIWSVGCILGELLGGKPLFRGKD
YVDQLNQILMILGTPKEATLTKIGSVRAQNYVRSLPIMRRVPYSELFPGANPLALDLLDK
MLTLDPFQRITVNEALNHPYLAIWHDPQDEPECTVKFDFTTFETVDDMDYMKQLIVEEVQ
NFRKFVRKPIQEQQHELHMQQQQQQQRQQQQQQQQQQQHQQQQQQQHQQQHQQHQQHQQH
QHQQHASQQHHQQQIQQVHQQHPSQQPQQQHRLPSDNISSPQTFEEFPGMMPPPGYAAGV
NNTGVLTNPEQLQNEHDISYYEQMPKPQELDEFAFMGQKADNPELFRLEEELGFGMDGAP
SFNA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggcttataatgggaaatcggttaataaggtgttcaaccaggattttatcatcgacaag
cgcttcaaaatcgtgaaggaattgggacatggagcgtatggaatcgtttgttcagcaaag
tacgatgatggtatgtctgacggccaggaaaacttcgtggccatcaaaaaaatcacgaac
atcttttccaaaaagatcttgtgcaagcgactgctccgtgagttgaagctcttgcagttc
ttccgtggccataaaaatattacttgtctctacgacttggatattgttccggacccagtc
actggtgatttcaatgaggtttacttgtacgaagaacttatggaatgcgacatgcatcaa
atcatccgtctgggtcagcctttgactgactcacattatcagctgtttgtgtatcagatc
ctatgcgggttgaagtacatccacagtgcggatgtgcttcatcgtgatttgaaacccggt
aacttgttggtcaatgcggattgtgaattgaaaatctgcgattttggcttggcccgtggc
ttttctgaagacgttgagcaaaatgcgggtttcatgaccgaatacgtggctactcgatgg
taccgtgctcccgaaatcatgctttctttttctaattacacaaaggctatagacatttgg
tctgttgggtgtatcttaggtgaactccttggaggcaaaccattgttccgaggaaaagat
tatgtggaccaactcaaccaaatcttgatgattttaggtactccaaaagaggccacgttg
accaaaattggctctgtgcgtgcccaaaactatgtgcggctgttgcctatcatgcgacgt
gtaccgtatctggagcttttcccaggcgcaaatcctcttgcgcttgatttgttggataaa
atgctcaccttagaccctttccagcgaattacagttaatgaggctcttaatcatccatat
ttggccatatggcatgatccgcaggacgaacctgagtgcacagttaagtttgattttact
accttcgaaactgtcgatgatatggactacatgaagcagttgattgtggaagaggtgcag
aacttccgtaaatttgttcggaaacccatccaagaacagcagcatgaacttcatatgcag
caacagcagcaacaacaacgacaacaacagcaacagcaacagcaacagcaacagcatcag
cagcagcagcaacaacaacatcagcaacaacatcaacaacatcagcaacatcaacaacac
caacaccaacaacatgccctgcaacaacatcatcagcagcaaattcaacaggttcaccaa
caacatccttctcagcagcctcaacagcaacatcgccttccatcggacaatatcagtctg
ccacagacatttgaagagtttccgggtatgatgccacctcctgggtatgctgcgggtgtg
aacaacacaggcgtgttgacaaaccctgaacaattgcaaaatgaacacgatattctgtat
tacgagcaaatgccgaaacctcaggagttggatgagtttgcattcatgggccaaaaggcc
gacaaccccgagctctttcgcttggaagaagaattggggtttggaatggacggcgctcca
tctttcaatgcctaa

DBGET integrated database retrieval system