KEGG   Clavispora lusitaniae: CLUG_04029Help
Entry
CLUG_04029        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
clu  Clavispora lusitaniae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CLUG_04029
Enzymes [BR:clu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CLUG_04029
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   CLUG_04029
  Exosomal proteins of colorectal cancer cells
   CLUG_04029
  Exosomal proteins of bladder cancer cells
   CLUG_04029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 552 aa AA seqDB search
MQFWKFSSQVLATVLATVSVVAASGPSDGDAIADPNSAVVKLTAKEFKSFLDENPLVLTE
FFAPWCGYCKQLGPELSKAADILNETHPKIKVAQVDCTEEETLCQQHQIRGYPTLKVMRG
AYNQPSDYNGPRSADGIVEYMIQQSLPPVQQVSDVEEIVKLSKSETKPFMIQVFPSAVHK
SAVAQNETFNDLASSQRSEMTFVSVETDAEIKKLNKLLDADISTKSASYLIVHPNELSDA
RVFSGEFSKENIDDWVKNAKVPYFGDINRDTYLVYMASTLPLGYYFYNDEAQRKEVDEFF
SKLGKKYSGKMNFVGLDASQFGRHAEILNMDPEIVPLFAVQNNSNGKKYGINQTEYPSGP
STEVISDFVEKFLAGEVEPIVKSEPLPTEEEVNAQAVVKLVAHNYMDVLNDTSKDVFIKY
YAPWCGHCKKLAPIWEELAEIYGSKDEDSKVVIANVDHTLNDVDTPIMIEGYPTLIFYPA
NGKVNEATGLREHVIFENARDLETLMEFIKKHGVNDVDGEKLKAAREAALQEAEDAEEDV
EEEESAADHDEL
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgcaattttggaagttttcttcgcaagttcttgctactgtgcttgctactgtgtctgtt
gtcgctgctagtggcccttctgatggtgatgctattgccgacccaaactctgctgttgtc
aagttgaccgctaaggaattcaaaagcttccttgacgagaatccattggtcttgactgaa
ttctttgctccatggtgtggttactgtaaacagttgggaccagaactctccaaggctgct
gacattttgaacgagacccacccaaagatcaaggtggcacaagtcgactgtacggaagaa
gagacattgtgtcaacaacaccagatcagaggataccctaccttgaaggttatgagaggt
gcttacaaccagccatctgactacaatggccctcgttctgcagatggaatcgtggaatac
atgatccagcaatctcttcctcctgttcagcaggtttctgatgtggaggagattgtcaaa
ctctctaaatctgaaactaagccattcatgattcaagttttcccatctgctgtccacaaa
tctgctgttgctcaaaatgaaactttcaacgacttggcctcctctcaaagaagtgaaatg
acatttgtctccgttgaaactgatgctgaaatcaagaagcttaacaagttgctcgacgcc
gatatctccaccaaatccgcttcttacttgattgtgcaccctaatgagttaagcgatgcc
agagtcttctccggtgagttttccaaggagaatattgatgactgggtcaaaaatgccaag
gttccctactttggtgacatcaacagagacacttacttggtttacatggcttccaccttg
ccattgggttactacttttacaatgatgaggcacaaagaaaggaagttgatgagttcttc
tccaaacttggcaagaaatactctggcaaaatgaactttgtcggtttggatgcttctcaa
tttggccgtcacgctgagatcttgaacatggaccctgagatcgttccattgtttgctgtg
caaaacaacagtaacggtaagaagtatggtatcaaccaaactgaatacccaagcggccca
tcaactgaagttatctctgacttcgttgaaaagtttttggccggtgaagttgagcctata
gttaagtccgaaccattgccaactgaggaagaggtcaatgcgcaagccgtcgttaagttg
gttgcccacaactacatggacgttcttaatgacacttctaaagacgttttcatcaaatac
tatgccccatggtgtggccactgtaagaagttggctcctatctgggaagaattggctgaa
atttatggctcgaaagacgaggactccaaggtggttatcgctaatgttgaccacactctt
aacgatgttgacacgccaatcatgattgaaggatacccaactctcattttttacccagcc
aacggtaaggtcaatgaggccactggtttgagagaacatgttatctttgaaaatgccaga
gatttggagactttgatggaattcatcaagaagcatggtgtcaacgatgttgatggcgaa
aagttgaaggctgctagagaagccgctcttcaagaagctgaagatgctgaggaagatgtt
gaagaagaggaatctgctgctgaccacgacgagttgtaa

DBGET integrated database retrieval system