KEGG   Clavispora lusitaniae: CLUG_04032Help
Entry
CLUG_04032        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
clu  Clavispora lusitaniae
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:clu00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:clu00280]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:clu00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MLSSKRSALRFLKTTRMASTGYAADDVLFHNENMARVITLNRTKKLNSLNTSMVTKIVPR
LSEYAKSDVCNLVILTSNSPKALCAGGDVAECAAQVLKGNAAYASDFFQKEYNMNYLIAT
YSKPYIALMDGITMGGGVGLSVHAPFRIATEKTKLAMPEMDIGFFPDVGTTFFLPRLDDH
LGYYYALTGEVLSGMDAYMAGFATHYIPSERLQHLVKRLSNLNPPVINGSPDDASVLKNQ
KDYFAQVNSVINEFAESKLPESYKFHLSDEEVSLINKAFSHETFEEALDTFKNAGTDFGT
TTFERLSAKSPTCVRVAFQLMKKGSKNSIRAQLETEMITATNMMNAKLEENDFVKGVKHK
LIDKIKTPNLPEWTPFDPSRVSKLISPSIHSAKLPSPLLEKFFGVNFTEYVFNMGLPKNG
QIENYITGRDGSNRSYLPTPSEVVKHFKSSTGNKLGVEEKVRRTLAIHGEASKYDNKYVS
WKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttatcttcgaagcgttcggccctccgtttcttaaaaactaccagaatggcgtctacc
gggtacgctgcagacgatgtcttgtttcacaatgagaacatggctcgcgtcatcacattg
aacagaacaaaaaagctcaactcgctcaacacctcgatggtgacgaaaattgttcctcgt
ttatctgaatatgctaagctggatgtttgcaatttggtgatactcacttctaactcgcct
aaagcactttgtgccggtggagatgtcgcagaatgtgccgctcaggtgttaaagggcaat
gcagcttatgccctggacttttttcaaaaggaatacaatatgaactatttgattgcaact
tactcgaagccatacattgcgctcatggatggaatcacgatgggtggcggtgttggtctt
tctgtccatgcgcctttccgtattgctacagaaaaaacaaaattggccatgccagaaatg
gacataggctttttcccagatgtggggactacctttttcttgccaagattagatgatcac
ttgggatactattatgccttaacgggtgaggttttatctggtatggatgcgtatatggct
ggctttgctacacattacattccttccgaaagattgcaacatctcgtgaagcgtttgtcg
aacttgaaccctccagttatcaatggttctccagacgacgcatcggttttaaagaaccag
aaggattactttgcgcaggtgaattctgtgattaatgaattcgccgaatccaaattacct
gaactgtacaaatttcacttatcggacgaagaagtatcattgattaataaagccttctcg
catgagactttcgaagaagcacttgatacattcaagaatgctggaactgactttggcaca
actaccttcgaacgcttgtcagcaaagtctcccacttgcgttcgcgtggcattccaatta
atgaagaagggctctaagaattctattcgtgcccaattggagacagaaatgatcaccgca
accaacatgatgaatgccaagctcgaggagaatgatttcgtcaagggtgtcaagcataaa
cttattgataagattaaaacccctaacttgcctgaatggactccgtttgacccctctcgc
gtttccaagttgatttctccatcgattcactctgcgaaactcccttcccctcttttagaa
aagttttttggtgttaacttcaccgaatacgtgttcaacatgggcttgcctaaaaatggg
caaatcgaaaattacattactggaagggacggatccaacagatcttacttgcctactcca
agtgaggttgtaaagcatttcaagagttccactggtaacaaattgggcgttgaagaaaaa
gtgaggagaacccttgccatacatggagaagcttccaagtacgacaacaagtacgtttca
tggaagggataa

DBGET integrated database retrieval system