KEGG   Clavispora lusitaniae: CLUG_04032Help
Entry
CLUG_04032        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K05605  
3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
clu  Clavispora lusitaniae
Pathway
Valine, leucine and isoleucine degradation
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CLUG_04032
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CLUG_04032
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CLUG_04032
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CLUG_04032
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     CLUG_04032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MLSSKRSALRFLKTTRMASTGYAADDVLFHNENMARVITLNRTKKLNSLNTSMVTKIVPR
LSEYAKSDVCNLVILTSNSPKALCAGGDVAECAAQVLKGNAAYASDFFQKEYNMNYLIAT
YSKPYIALMDGITMGGGVGLSVHAPFRIATEKTKLAMPEMDIGFFPDVGTTFFLPRLDDH
LGYYYALTGEVLSGMDAYMAGFATHYIPSERLQHLVKRLSNLNPPVINGSPDDASVLKNQ
KDYFAQVNSVINEFAESKLPESYKFHLSDEEVSLINKAFSHETFEEALDTFKNAGTDFGT
TTFERLSAKSPTCVRVAFQLMKKGSKNSIRAQLETEMITATNMMNAKLEENDFVKGVKHK
LIDKIKTPNLPEWTPFDPSRVSKLISPSIHSAKLPSPLLEKFFGVNFTEYVFNMGLPKNG
QIENYITGRDGSNRSYLPTPSEVVKHFKSSTGNKLGVEEKVRRTLAIHGEASKYDNKYVS
WKG
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgttatcttcgaagcgttcggccctccgtttcttaaaaactaccagaatggcgtctacc
gggtacgctgcagacgatgtcttgtttcacaatgagaacatggctcgcgtcatcacattg
aacagaacaaaaaagctcaactcgctcaacacctcgatggtgacgaaaattgttcctcgt
ttatctgaatatgctaagctggatgtttgcaatttggtgatactcacttctaactcgcct
aaagcactttgtgccggtggagatgtcgcagaatgtgccgctcaggtgttaaagggcaat
gcagcttatgccctggacttttttcaaaaggaatacaatatgaactatttgattgcaact
tactcgaagccatacattgcgctcatggatggaatcacgatgggtggcggtgttggtctt
tctgtccatgcgcctttccgtattgctacagaaaaaacaaaattggccatgccagaaatg
gacataggctttttcccagatgtggggactacctttttcttgccaagattagatgatcac
ttgggatactattatgccttaacgggtgaggttttatctggtatggatgcgtatatggct
ggctttgctacacattacattccttccgaaagattgcaacatctcgtgaagcgtttgtcg
aacttgaaccctccagttatcaatggttctccagacgacgcatcggttttaaagaaccag
aaggattactttgcgcaggtgaattctgtgattaatgaattcgccgaatccaaattacct
gaactgtacaaatttcacttatcggacgaagaagtatcattgattaataaagccttctcg
catgagactttcgaagaagcacttgatacattcaagaatgctggaactgactttggcaca
actaccttcgaacgcttgtcagcaaagtctcccacttgcgttcgcgtggcattccaatta
atgaagaagggctctaagaattctattcgtgcccaattggagacagaaatgatcaccgca
accaacatgatgaatgccaagctcgaggagaatgatttcgtcaagggtgtcaagcataaa
cttattgataagattaaaacccctaacttgcctgaatggactccgtttgacccctctcgc
gtttccaagttgatttctccatcgattcactctgcgaaactcccttcccctcttttagaa
aagttttttggtgttaacttcaccgaatacgtgttcaacatgggcttgcctaaaaatggg
caaatcgaaaattacattactggaagggacggatccaacagatcttacttgcctactcca
agtgaggttgtaaagcatttcaagagttccactggtaacaaattgggcgttgaagaaaaa
gtgaggagaacccttgccatacatggagaagcttccaagtacgacaacaagtacgtttca
tggaagggataa

DBGET integrated database retrieval system