KEGG   Clavispora lusitaniae: CLUG_04129Help
Entry
CLUG_04129        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CLUG_04129
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   CLUG_04129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 251 aa AA seqDB search
MDYDLARVIYSAVQFSEFHIRSFVYQILCGVHFAHSANIVHRDLKPGNILVNSQGVLKIG
DFGLARSLVSSPAAVHSPITNYVATRWYRAPELILQQSTYGKPVDLWAVGCILAELYGRR
PLMPGKSSLQQLHEIVKYLGSPPRSLTRSSWDLPVCNLSPIAWVSVYPFASEEALDLLGQ
LLVWEPSRRLSASQALRHDYLVSVSSQKEVSASAPYKAGPEEQEKDIESLSELLQQEVAL
FQKERATGQAY
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggattacgacttggcccgagtcatatacctggcggtgcagttttctgagtttcacatc
cgcagctttgtttaccagattctctgtggggtgcatttcgcccactcggccaatattgtg
caccgagacttgaaaccaggaaacatcttggtgaattcgcaaggggtgctcaaaatcggc
gactttggcctcgcccgctcgcttgtatcttctccagctgccgtccatagccctataaca
aactacgtggctactcgctggtacagggcgcccgaactcatactccaacagtcaacttat
gggaagcccgtggacctttgggccgtgggatgtattttggccgagctatatggccgccgc
cctctcatgccgggaaagtcgctgctccaacagctccatgaaatagtaaagtatttgggt
tctccgcctcgaagtttgactcgaagcagttgggacttgcctgtgtgcaacttgctgccc
attgcttgggtttccgtttacccatttgcttctgaggaagctttggatctcttgggccag
cttttagtctgggaaccttccagaaggctcctggcatcccaagcacttagacacgactac
ttagtatcagtaagtagccagaaagaggtactggctctggctccatataaggcaggcccc
gaggaacaggaaaaggatatcgagctgctaagcgagttgctacaacaagaagtagcactt
ttccagaaagaacgggccacgggacaggcgtactaa

DBGET integrated database retrieval system