KEGG   Clavispora lusitaniae: CLUG_04133Help
Entry
CLUG_04133        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
clu  Clavispora lusitaniae
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:clu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 474 aa AA seqDB search
MKNYLLIALAAGVLASPTQNVQQIPIPEKSEMENDYPAQESYIDQLYGPLVSTPDSWQHR
RQLVASGVQNFKEEEQFIESFPFSDGQWLTQNIQKMHLNQQKSHRNAAHSGYLKYRSQVK
FPNNDETSDISNDPSHFGGIITFGGFDHFDCFNPQYYKKPIDIAIVGAPFDTGTSYRPGA
RFGPEAIRSAARRLGGGVTPVRGNGPQSKLGQVDPYDRRTHNLSIVDCGDVPMTPFDNRI
ALNQLYRGQRAIHNHSVSAGAKSVPHPKIITMGGDHTITLMALRSAYEKYGKLAVLHFDS
HIDTWDPKVLGGGITDYMSLNHGTFLHYAAENGYLEQGHCFHLGLRAPYIRPSYDKKHDS
ACGFETISARDLDRLGMHHIVTKIKESVKDMPVYISVDIDVLDPANAPGTGTMEIGGWTG
RELLSVLDGLEGINLVGGDVVEVSPPFDTNSEITSLAATAVIDSLLGLMVVEEM
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaactaccttttgatagcattggctgcgggtgttctcgcatctcccacacagaat
gtgcagcagatcccaattccagaaaagtccgagatggaaaatgattatccagctcaggag
tcctacatcgaccagttatatggcccattagtctcaaccccagactcttggcaacacaga
aggcaattggttgccagtggtgtccaaaactttaaggaggaagaacagtttattgaatcc
tttccgttttcggacggacagtggctcacacagaatatacagaagatgcacctcaaccag
cagaaaagccatcgcaatgcagcacattcgggctacttgaagtaccggctgcaagtgaag
tttccaaacaatgacgaaacctctgacatttcaaacgacccaagccattttggcggcatt
atcacttttggtggttttgaccactttgattgtttcaatccccagtactacaagaaaccc
attgacatcgccattgtcggagctccttttgatactggaacctcatatcgaccaggagct
cgttttgggcctgaagcgattcgcctggctgctcgcagacttggtggaggtgtcacacca
gttcggggaaacggaccgcaatccaaacttggccaggtcgacccgtacgaccgcagaacc
cacaatttgtcgatagtcgactgcggggatgtgccaatgacaccgtttgacaatcggatt
gccctcaatcagctctaccgaggacaaagagcaatacacaaccatagtgtgagtgctggg
gcgaaactggttccacatcccaaaatcattacaatgggaggagaccacactatcacctta
atggcgttgcggtctgcttatgaaaagtatgggaagcttgccgtattgcacttcgactct
cacattgatacttgggatccaaaagtattgggcggtggaattactgattacatgtctttg
aaccatgggactttcttgcactatgcggcagaaaatgggtatttggaacaaggtcattgt
ttccatttgggcttacgagcaccctatatccggccctcttacgataagaaacatgattcc
gcttgtggtttcgaaaccataagtgctagagacttggacagactaggaatgcaccatatc
gttacgaagatcaaagaaagtgtgaaggatatgccagtatacatttctgtcgacattgat
gttttagacccggccaatgccccaggtacaggaaccatggagattggaggctggaccggt
agggaattgctttctgtcttggatggtcttgaaggcatcaatttagttggaggcgatgtg
gtggaagtaagtccgcctttcgataccaacagtgagatcacgagtttagcagcaacagcc
gttattgactcattattggggcttatggtggtggaggaaatgtaa

DBGET integrated database retrieval system