KEGG   Clavispora lusitaniae: CLUG_04156Help
Entry
CLUG_04156        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K12666  
oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
clu  Clavispora lusitaniae
Pathway
N-Glycan biosynthesis
Various types of N-glycan biosynthesis
Metabolic pathways
Protein processing in endoplasmic reticulum
Module
Oligosaccharyltransferase
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:clu00510]
Metabolism; Glycan biosynthesis and metabolism; Various types of N-glycan biosynthesis [PATH:clu00513]
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:clu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 460 aa AA seqDB search
MLPWIFLALFAIAHALESWENVHYHRSVDLSKSYVRELCLVEAKNTGDTPQDTYIFRVND
GMDAVPEVASVGGVLIDQRLALAVSEQEAGVYSVKFPFPVAPASSVEFEVFYAYTNTLVP
LPEKIEMADRQMLLLKTNKLPYSDYKTSEYSLAFRGFSVGQELDLQPSTPVSPDLPHLSG
HVDKDAQALTYGPQIVDVPPLSVSPMGLLYEHNKPVTRVVTLERSVWVPGSDVGVVQTED
YYELYNNGAQLKSGYSRVEWLKGRFDMVRDHHALSRLEFPLGDRDPLENYYFTDKVGKVS
SVSQVPGHVVFQPRFPLFGGWKYNFTMGWTNGIANFVRRVDADTYVAQFPLVSNLRDIYY
DNVSVSVLLPENAEVIDVQSTVPSTSSVGRELSYLDVADGHVKVTLHFRNLQDSHSASTV
LVKYRYTAQSFWKKVGTIAAWVFTALASYYALGLLDLSVN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgtggatctttcttgcgctttttgcaattgcacatgcgctcgagctgtgggag
aacgtccactaccatcgtagtgtggatctctccaaatcctacgtcagagagttgtgccta
gtcgaggcgaaaaacaccggcgacacgccccaggacacgtatattttccgcgtcaacgac
ggaatggatgccgttcccgaggtggcatccgtgggcggtgttttgatcgaccagcgcttg
gcgttggccgtgtccgagcaagaggctggcgtttacagcgtcaaattcccattccccgtg
gcgccagcgtcgtccgtggaattcgaagtgttctacgcgtacacaaacacgttggtgcct
ttgcccgagaagatcgaaatggcagaccgccagatgttgttgctcaagaccaacaagctc
ccatactcggactacaagacctccgagtactcgcttgcgttccgtggattcagcgtgggc
caggagttggatttgcagccaagcactcctgtgtcgcctgatttgccccacttgagcggt
catgtggacaaggacgcccaggcgttgacgtacggcccgcaaatcgtggatgtgcctcca
ttgtctgtttcaccaatgggcctcttgtacgaacacaacaagccagtgactcgcgtggtg
acacttgagcgcagcgtgtgggtgcctggctcggacgtgggcgttgtgcagacagaagac
tactacgagctctataacaatggggcccagcttaaatcgggctactcgcgggtggaatgg
ttgaagggccgttttgacatggtgcgtgaccaccacgcgctctcgcgcttggaattccca
cttggcgacagagacccgcttgaaaactactacttcaccgataaagtgggcaaggtgtct
tctgtgctgcaggttccaggccacgtggtcttccagcctcggttcccgcttttcggagga
tggaaatacaacttcaccatgggctggacaaacggcattgccaactttgtccgccgtgtg
gatgcagacacatatgtggcccaattcccgttggtgagcaatctccgtgacatttactac
gacaatgtcagcgtcagcgtgcttttgccggaaaacgccgaggtcatcgatgtgcagagc
actgttccttccacttcgtctgtgggccgcgagttgagctacctcgacgtggctgacggc
catgtcaaggtgacactccacttccgcaacttacaggacagccacagcgcttcgactgtt
cttgtcaagtacagatacacggcgcagagtttctggaagaaggtgggcactattgccgca
tgggtgtttaccgctttggccagttactatgcgttgggtcttcttgacttgtcggtcaat
tga

DBGET integrated database retrieval system