KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04156Help
Entry
CLUG_04156        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00510  N-Glycan biosynthesis
clu00513  Various types of N-glycan biosynthesis
clu01100  Metabolic pathways
clu04141  Protein processing in endoplasmic reticulum
Module
clu_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    CLUG_04156
   00513 Various types of N-glycan biosynthesis
    CLUG_04156
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CLUG_04156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribophorin_I
Motif
Other DBs
NCBI-GeneID: 8495849
NCBI-ProteinID: XP_002615274
UniProt: C4Y7H8
AA seq 460 aa AA seqDB search
MLPWIFLALFAIAHALESWENVHYHRSVDLSKSYVRELCLVEAKNTGDTPQDTYIFRVND
GMDAVPEVASVGGVLIDQRLALAVSEQEAGVYSVKFPFPVAPASSVEFEVFYAYTNTLVP
LPEKIEMADRQMLLLKTNKLPYSDYKTSEYSLAFRGFSVGQELDLQPSTPVSPDLPHLSG
HVDKDAQALTYGPQIVDVPPLSVSPMGLLYEHNKPVTRVVTLERSVWVPGSDVGVVQTED
YYELYNNGAQLKSGYSRVEWLKGRFDMVRDHHALSRLEFPLGDRDPLENYYFTDKVGKVS
SVSQVPGHVVFQPRFPLFGGWKYNFTMGWTNGIANFVRRVDADTYVAQFPLVSNLRDIYY
DNVSVSVLLPENAEVIDVQSTVPSTSSVGRELSYLDVADGHVKVTLHFRNLQDSHSASTV
LVKYRYTAQSFWKKVGTIAAWVFTALASYYALGLLDLSVN
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttgccgtggatctttcttgcgctttttgcaattgcacatgcgctcgagctgtgggag
aacgtccactaccatcgtagtgtggatctctccaaatcctacgtcagagagttgtgccta
gtcgaggcgaaaaacaccggcgacacgccccaggacacgtatattttccgcgtcaacgac
ggaatggatgccgttcccgaggtggcatccgtgggcggtgttttgatcgaccagcgcttg
gcgttggccgtgtccgagcaagaggctggcgtttacagcgtcaaattcccattccccgtg
gcgccagcgtcgtccgtggaattcgaagtgttctacgcgtacacaaacacgttggtgcct
ttgcccgagaagatcgaaatggcagaccgccagatgttgttgctcaagaccaacaagctc
ccatactcggactacaagacctccgagtactcgcttgcgttccgtggattcagcgtgggc
caggagttggatttgcagccaagcactcctgtgtcgcctgatttgccccacttgagcggt
catgtggacaaggacgcccaggcgttgacgtacggcccgcaaatcgtggatgtgcctcca
ttgtctgtttcaccaatgggcctcttgtacgaacacaacaagccagtgactcgcgtggtg
acacttgagcgcagcgtgtgggtgcctggctcggacgtgggcgttgtgcagacagaagac
tactacgagctctataacaatggggcccagcttaaatcgggctactcgcgggtggaatgg
ttgaagggccgttttgacatggtgcgtgaccaccacgcgctctcgcgcttggaattccca
cttggcgacagagacccgcttgaaaactactacttcaccgataaagtgggcaaggtgtct
tctgtgctgcaggttccaggccacgtggtcttccagcctcggttcccgcttttcggagga
tggaaatacaacttcaccatgggctggacaaacggcattgccaactttgtccgccgtgtg
gatgcagacacatatgtggcccaattcccgttggtgagcaatctccgtgacatttactac
gacaatgtcagcgtcagcgtgcttttgccggaaaacgccgaggtcatcgatgtgcagagc
actgttccttccacttcgtctgtgggccgcgagttgagctacctcgacgtggctgacggc
catgtcaaggtgacactccacttccgcaacttacaggacagccacagcgcttcgactgtt
cttgtcaagtacagatacacggcgcagagtttctggaagaaggtgggcactattgccgca
tgggtgtttaccgctttggccagttactatgcgttgggtcttcttgacttgtcggtcaat
tga

DBGET integrated database retrieval system