KEGG   Clavispora lusitaniae: CLUG_04172Help
Entry
CLUG_04172        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CLUG_04172
    1.3.1.94  polyprenol reductase
     CLUG_04172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 282 aa AA seqDB search
MLACILLHTSVFSQSGMLVCQAITAGFAAASALILFTKLYTPLNQLLAYGKVAQGPKSTQ
TGFARLVQIASRWTVPKQYFVHFYILFAVLQWLQLPWAKGKLLHTNFGLAWLLLTAQATR
RLMESLLLTQWGSKSRMHISHYFVGLYFYVCVAIVSFCGLVVAQEESKRPRQWLAIAFFA
LFSVDQYNNHRHLAALVKYSVPTFGMFRHVACAHYCDEIVIYFAVTVAAWTREPNMEVSV
ALFSAWVFVLVNLSVSGLESLRYYQTKFDDYTVQYAVVPFLL
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcctgcattttacttcatacatctgtcttctcacaactgggaatgctagtttgc
caggctattactgccggctttgccgcagcttcggctcttatattgttcacgaagctttac
accccactcaatcagctacttgcatacggaaaagttgcacagggtccaaaaagcacccag
actggttttgctcgccttgtgcagatcgcttcacgttggacggtaccaaagcagtacttt
gttcatttctacattttgtttgccgttttacaatggctccagttgccgtgggcgaaagga
aaactcttacacaccaacttcggtttagcgtggctcctattaaccgcacaagccacccga
aggctcatggaaagccttcttcttactcaatggggcctgaaatcacgcatgcacatctcc
cattactttgttggcctctacttctacgtttgtgtcgctatcgtctcgttttgtgggctt
gtggtggctcaagaagaatctaagagaccacgtcaatggctagctatagctttctttgca
ttgttttccgtggaccagtacaataaccatcgccatttagcagcacttgtcaagtactct
gttcctacttttggcatgtttcggcatgttgcatgcgcccattactgcgacgagattgta
atctactttgcagtgacagttgcagcgtggacgcgagagccgaatatggaagtgagcgtg
gccttattctctgcttgggtgtttgttcttgtcaatcttagtgtgagcggtttggagtcg
ctccgctactatcaaacgaagtttgacgactacacggtacagtatgcggtggtgccgttc
ttgttgtga

DBGET integrated database retrieval system