KEGG   Clavispora lusitaniae: CLUG_04226Help
Entry
CLUG_04226        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
clu  Clavispora lusitaniae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    CLUG_04226
Enzymes [BR:clu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     CLUG_04226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 385 aa AA seqDB search
MNILFLLFALGVFASELVRINDKNFKEVAVESGKWTLVDFYADWCRHCSNLMPTIEQLAE
VYKDEPDIQIVKLNGDEDGKKTTRKYNVPGFPTLLMFHGSDDPIEYEGMRDLDAISNFVQ
SVSGIRLGAKPAPEVVEPTNILSLNDDNFQDTVLRANHKTVVAVTAPWCRFCKELEPIFN
KLANEIYIHDGEVVQFGKVDLSDENKQKCEMITKQFGVEKLPTIFLFDPSRVDKDGLRRP
VIFNDDRDLESLIAFVNDETGLCRNEEGRLHSNAGRIMAIDQALKTKSPEAILEELETLE
EEVKIYGRDALVNDDVLFFKDDVSMIPYYKKLLKKIQEGDREFFSREFARLERLLATEEK
NIEKGAYDHMQKRASVLQSFLSAKA
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacattctcttcctcctttttgctcttggtgttttcgcatccgagttggtgcggata
aacgataaaaacttcaaagaagtggccgtggaatccggaaaatggactttggtggatttt
tacgcagactggtgcagacattgttctaaccttatgccaactattgagcagcttgctgaa
gtgtacaaagacgagcctgatattcagattgtcaaattgaatggtgatgaggatggtaag
aaaactacccggaagtataacgtgcccggtttcccaactttgttaatgttccacggatct
gatgatcctatcgagtatgagggaatgagagatttggatgctatcagcaacttcgtccag
agtgtgtctggaatcagacttggcgcgaagccggctccggaggttgttgagcccaccaat
attctctctttgaatgatgataattttcaagatactgtacttcgggccaaccacaagaca
gtcgttgcggtcacggccccatggtgccggttctgcaaagagcttgagcctatttttaac
aagcttgcgaatgaaatttacatccatgacggagaagttgttcaatttgggaaagtggac
ttaagtgatgagaataaacaaaagtgtgaaatgatcaccaagcaatttggcgttgaaaaa
ttgcccactatctttttgtttgatccactgagggtcgacaaggatggattgaggagacct
gttatctttaacgacgaccgtgacttggaatcgttgattgcgttcgtaaatgacgagact
ggattgtgcagaaacgaagaaggtagattgcactcaaacgccggaagaatcatggcgatt
gaccaagcacttaaaacaaaaagtccggaagctatcttagaggagcttgagactttggaa
gaagaagtgaagatatatggtagggacgctttggtgaatgatgacgttctctttttcaaa
gacgacgtttccatgatcccttattacaaaaagctcttgaagaagatccaagaaggcgac
agagagtttttctctcgagaattcgccagacttgaacggttgctcgctacagaagagaaa
aacatagaaaaaggtgcttacgatcacatgcaaaagcgggccagcgtgttgcagagcttc
ctttcagcaaaagcatag

DBGET integrated database retrieval system