KEGG   Clavispora lusitaniae: CLUG_04515Help
Entry
CLUG_04515        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
clu  Clavispora lusitaniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLUG_04515
Enzymes [BR:clu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CLUG_04515
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     CLUG_04515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1228 aa AA seqDB search
MPSRTVLLRLSDSGEPLNTNNDTNGVLLLPSLASEKNHHEDETIFDLKIVLNAAAKVSRN
GVFKTNAPLDAKTKFQRDTFYDVPLTSSFHKDISLTIPIYKPGPYAFYIRYEEADNTPTE
TDHFYFTVPPQLFINSKYLPFNSINLQTVVSKWIGPLDHWNEFFAYVAKKGYNMIHFTPL
QERGSSDSPYSIYDQLRFDPKLFGSNEKASSVIRNAMSQNGLLAMTDVVWNHTADNSAWI
RDAPDAGYNAETAPHLRAAIELDEALSSFSDRLEELNLPTDIKSEEDLKNIIEGINNHVL
NPLNLWQYYVFEKVELTEQLQKLYEKESVTPSEIPSSVDVSDLTALASFVVSSASLHGKA
IFEDRFSNKLDPAKFLGILLTLVQKNETSFEEIADKASHIVDEINLKLYAQYDDDVASIK
TQLTDRIRYLRLADNGPKLGPITKKNRVAEPYFTRFTDKHGKKWALANNGWIWGGDPLVD
FASNKSRAYIRREVIVWGDCIKLRYGSGPQDSPALWKRMIQYTKDCAKLFDGFRLDNCHS
TPLHVGEALLDAARSVNPNLYVVAELFTGSEAMDKIFVQKLGINSLIREAMQAWDVQELS
RLVHKHGGRPIGSLSWLPLDEFSYPAGKEPKTGKHLGSNSELQIPQVLTAHAPHALFMDC
THDNQTPAQIRTIEDSLPTAALVALCSSAIGTVFGFDETYPELLDVVGEKRQYAYDDNIG
IAKAKMKLNEVRNKLASESTDAYAEQEMYVHHEGQYITIQRYNTRTGEGWFLIARSKFNG
HEGEQILSPVDLKGTEIKYEFGYRLEKTGEYSRDDKRITGIPTKLIDLESPEIIRNESGY
VIKTDGSFEPGSIAVFSTKIPTANENLDKYVKEGAIEASLGLNLYDLNAILYRCESEERD
ASHGAEGTYNIPGSGQLVYAGLEGWISVLKDVIWNNDLAHPICNHLREGFWAADYVVNRL
DKYAKESEAIGKFRDWIKSRMDAIKEVPYYLRPHYFALVVGVAYEAARFRALAQMDDKIK
NATNFVQSLALTSVQMCGFMNNTSLLPDKKVACLAAGLPHFSTDYMRCWGRDVFISFRGL
LLVPGRFDDAKQHILGFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFTQAVQEYVKYAPN
GERILDEKVSRRFPLDDTYIPWDDEKAFSYETSIRDILYEILSRHAKGIKYREANAGPNL
DSQMKDEGFNVEVSVPLTTGSASSTVDP
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctcgaactgtgcttcttagactctccgactccggagaacccctaaacacaaat
aacgacacgaatggtgtcttgcttttgccgtcattggcttccgaaaagaaccaccatgaa
gatgaaacaatttttgacttaaagattgtgctcaatgcagctgcgaaagtaagccgcaat
ggtgttttcaagaccaatgcccctttggacgcaaaaaccaagtttcaaagagacaccttc
tacgatgtacctctcaccagctcgtttcacaaggacatttcgctcacaattccaatttac
aagcctggtccttatgctttctacattcgttacgaagaggctgacaatacaccaaccgaa
acagaccacttttacttcacagtacctccccagcttttcatcaactccaagtatcttcca
ttcaactccatcaacttgcagactgtcgtatccaaatggattggaccattagatcactgg
aatgagttctttgcttatgtggctaaaaaaggatacaacatgatccattttactcctttg
caggaaaggggcctgtctgactctccgtattctatttacgaccagcttcgtttcgatccc
aaattgttcggtagcaacgagaaagcactgtccgtcatccgtaatgccatgtcacaaaac
ggcttattggccatgactgatgtggtttggaaccatactgccgacaattcagcatggatt
cgtgatgcacctgatgctggatacaatgcggagacagcgccacatttacgggcagcaatt
gagttggacgaagctctttcatccttcagtgacagattggaagagttaaatttgcccact
gatatcaaatcagaagaggacttaaagaatattattgaaggtatcaacaatcacgtgttg
aatcctctcaacttatggcagtactacgtttttgaaaaagtcgaattgaccgaacagttg
caaaaactttatgaaaaagagtctgtcacaccaagtgagattccatcctcagtggacgtg
tctgacttgaccgctttagctagttttgtcgtctcttctgccagcttgcatggtaaagcc
atatttgaggatagattttctaacaaattagatcccgcaaagtttcttggtatattgttg
actttggtacagaagaatgagaccctgtttgaagagattgccgacaaggcctcacatata
gtggacgaaattaacttgaagttgtacgcgcaatatgatgatgatgttgcttcaataaag
acgcagctcacagacagaatccgttacctcagattagccgataacgggccgaaattgggg
cctattacaaagaaaaacagagtcgccgaaccttattttactagattcacagacaaacac
ggtaaaaaatgggccttggccaataatggttggatatggggtggtgatcctcttgttgac
tttgcttcaaataagtctagggcttatattcgcagagaagttattgtttggggtgactgt
atcaagttgaggtatggctccggtcctcaagactctcctgcgttgtggaagagaatgatt
cagtacaccaaagactgtgcaaaactatttgacggtttcagattggacaactgccactct
acacctttacatgttggtgaagctttgttggatgcggcaagatcagtgaatcccaacttg
tatgtggttgcagaattgtttacaggttctgaagccatggacaaaatcttcgtacaaaaa
ttaggtatcaattctttgatcagggaagcaatgcaagcatgggatgtccaggaattgtcg
aggttggttcataagcatggaggcagaccgattgggtctctttcttggcttcctttggat
gaattctcgtatcctgctggaaaagaaccaaaaactggaaagcatttgggaagcaactcc
gagttgcaaattccacaagttctcacagctcatgcacctcatgctttgttcatggattgt
acgcatgataatcaaacgcctgcgcaaattagaaccatagaggattcattgcctactgct
gcattagttgcgctttgttcttcagctatcggcactgtcttcggtttcgacgagacttat
cccgaacttctcgatgttgtgggagagaagagacaatatgcttatgatgataatattgga
attgccaaagcaaaaatgaagttgaatgaagttagaaacaaacttgctctggaaagcact
gatgcctacgctgaacaggagatgtatgtgcatcacgagggccagtacataacaattcag
cggtacaacactagaaccggtgaaggttggtttttgattgcaaggagtaagttcaatggg
catgaaggagagcaaatattgtctcctgtcgatttgaaaggaactgagatcaagtacgag
tttggttacagattggagaaaacaggcgaatattcgcgtgacgacaaaagaataacaggc
attcctacgaagctcattgaccttgaatctcccgaaatcatccgtaatgaatctggctat
gtgatcaagacagatggaagctttgaaccaggatccatcgctgtcttttctactaaaatt
cccacagcaaacgagaacttggataagtacgtcaaagaaggtgcaattgaagcatctttg
ggccttaacttgtacgatttgaacgccattttgtacagatgtgagtctgaagaaagggat
gcaagccatggtgcagaaggcacttacaatatcccgggatctggccaattagtgtacgct
gggttagaaggatggattctggttttaaaagatgttatttggaataatgatcttgctcat
ccaatctgtaatcacttgagagagggattttgggcagcagactacgtggtgaatcggttg
gacaagtatgccaaagaatcggaggcaattggcaaattccgtgactggattaagtctcgt
atggatgctatcaaggaagttccatactacttacggcctcattactttgccctcgtggtt
ggtgttgcttatgaagctgcccgcttcagagctttggcgcagatggatgataagataaaa
aatgctacaaactttgttcaaagtttggcattgacctctgttcaaatgtgtggcttcatg
aacaatacatcacttttgcctgataagaaggtggcttgcctcgctgctggtcttccgcat
tttagtacagattatatgagatgctggggtcgtgatgtattcatttctttccgagggctc
ttattggttccaggaagatttgatgacgccaagcagcatattctcggttttgctaagacc
ttgaagcatggattgattcctaatttacttgacgctggaagaaacccaagatacaatgca
agagatgctgcatggttttttactcaagctgtccaagagtatgtgaaatatgctccaaat
ggagaaagaatattggacgagaaagtgagcagacggttcccattggatgacacttatatt
ccctgggatgacgaaaaggctttcagttacgaaacatctatcagagatattctctacgag
attttgctgcgtcacgcgaaggggatcaaatatagagaagcgaatgcgggaccaaatctt
gatctgcagatgaaagatgaagggttcaatgttgaagtttctgttcccctcacaacggga
ctggcctcgtccacggtggatccc

DBGET integrated database retrieval system