KEGG   Clavispora lusitaniae: CLUG_04624Help
Entry
CLUG_04624        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K07203  
FKBP12-rapamycin complex-associated protein
Organism
clu  Clavispora lusitaniae
Pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:clu00001]
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    CLUG_04624
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CLUG_04624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 677 aa AA seqDB search
MLRRLKKSKSQQQEVISIDVVQRHVIPSIEGFFHSIALSQSNSLQDTLRLLTLWFKFGGI
PEAAQAMSDGFGMVKIDNWLQAVPQLISRIHQPNQIVSASLLGLLTDLGKAHPQALVYPL
AVAVTSESVNRKKAALSIIDKMRIHSATLVEQSELVSHELIRVAVLWLEQWYEGLEDASR
LFFGEHNTEKMFEVLEPLHKMLQKGPETMREASFNNAFGRELADAYEWVLNYRRTKDITN
LNQAWDVYYNVFRRISRQLPQLQSLELSFVSPKLEAMKDLELAVPGSYEPGKPIVKIAKF
EPTFTVISSKQRPRKLVCKGSDGKDYQYLLKGHEDIRQDNLVMQLFGLVNTLLLNDTACF
KRHLDIQQFPAIPLSPKVGLLGWVPNSDTFHVLIREYRESRKILLNIEHRIMLQMAPDYD
SLTLLQKVEVFTGALDNTRGQDLYKVLWLKSKSSEAWLDRRTTYTRSLAVMSMVGYILGL
GDRHPSNLMLDRITGKVVHIDFGDCFEAAILREKYPEKVPFRLTRMLNYAMEVSGIEGSF
RITCEHVMRVLRDNKESLMAILEAFAYDPLINWGFDFPTKALAEATGIKVQQHNTKEMLK
KGEIDEEEANRLNKLNALEIRNARAALVLKRITDKLTGNDIKRLKNLDIPTQVDKLIQQA
TSVENLCQHYIGWCSFW
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgcttcggagactcaagaaaagcaagtcccaacaacaggaggtcatttcaattgatgtt
gtacaacgccacgtaattccttccattgaaggtttctttcattcgatcgctttgtcacaa
tccaactccttgcaagatacattaagattgttgacattatggttcaaatttggtggaatt
cctgaagccgcacaggctatgtcagatggttttggaatggtgaaaattgataattggttg
caggctgttccacagttgatttcccggattcatcaaccaaaccagatagtcagtgcatcc
ttgttggggctcttgacagatttaggaaaggcccaccctcaagccttagtgtatccatta
gcagttgctgttacttcagagtctgttaacagaaagaaggctgcattgtctattatcgac
aagatgagaattcattcagcgacattagttgaacaatccgagttggtgagtcatgaatta
atccgtgtggcagtattatggcttgaacaatggtacgaaggattggaagatgcttcaaga
ttattctttggcgaacataatacggagaaaatgtttgaagtattagaacctttgcataaa
atgcttcaaaagggaccagagacgatgcgtgaagcatctttcaacaatgcttttggaagg
gagcttgccgatgcttatgaatgggtattaaattatcgcaggacaaaggatatcacaaac
ttgaaccaggcttgggatgtttactacaatgtattccgcaggattagtagacagttaccg
caacttcaaagtttggaattactgttcgtgtcaccaaaattagaagcgatgaaagacttg
gagctagctgtgccaggtagctatgagccaggaaagcctattgttaaaattgcgaaattt
gaaccaactttcactgtgatttcttcaaagcaacgaccaagaaaattggtttgcaaggga
agtgacggtaaagattatcagtacttgttgaaaggacatgaggatatcagacaggataac
cttgtgatgcaattatttggattagtcaacacgttacttctcaatgacactgcttgtttc
aagagacatttagacattcagcaatttccagctataccactatctccaaaagtgggtttg
ttgggctgggttcctaacagtgatactttccacgtcttgatcagagaataccgtgagtcg
agaaagattttattgaatattgaacacaggattatgttacaaatggccccagattatgat
agtttaacacttcttcagaaggttgaagtttttactggagcattggataatacccgaggt
caggacttgtataaagttttatggctcaagtctaagtcttcggaagcctggcttgatcgt
agaacaacatacactcgttctttggcagttatgtctatggtcggatatatcctcggttta
ggagataggcatccatcaaacttgatgcttgaccgaattactggtaaagttgttcatatt
gattttggagactgttttgaagctgctattttgcgggagaaatacccagaaaaagttccg
ttcagactcacaagaatgctcaactatgcaatggaagtcagtggaatagaaggttcgttt
agaatcacttgcgaacacgttatgagggtgttacgggacaataaggagtcattgatggcc
attttggaagcattcgcatatgatccattgatcaattggggttttgacttccctacaaag
gcattagccgaggcaacagggattaaagtgcaacaacataatacaaaagagatgttgaag
aaaggtgaaattgacgaggaggaggccaatagacttaacaagctcaatgctttggagatt
agaaatgccagagctgctttggtccttaagcgcatcactgacaaattaacgggcaatgat
atcaaaagattgaaaaatttggatattccaacgcaagtggataaattgattcaacaagct
acaagtgtggagaatttgtgtcagcattacattggctggtgttccttctggtaa

DBGET integrated database retrieval system