KEGG   Clavispora lusitaniae: CLUG_04627Help
Entry
CLUG_04627        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
clu  Clavispora lusitaniae
Brite
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   CLUG_04627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1298 aa AA seqDB search
MSSPQLQVVDGIALNQIFLGLKSSNEEDRSRSAIELRNFLASIARDLTPEQFNKYNNEIN
KTIFDFLQSKDTVQTLGGIAALNALIDFDSGVGEENATKTARFSNYLSSLILSNDLTIMK
QATKTLGKLATPRGTLTGDFVDFEAKKAIEWLQSDNRQHENRRHAAILIISALADNAPLL
LQGYITQILEHIWIPLKDNKLIIRTDAAETLQKCMSILYSRDVELRKKWIRILIDSASKI
LNESGMKPNNGGSSSSYNLIYSANGYSSEAIHGALLVYRELVKYYEDPYIKYMFETMYEN
ITIYKNHKMSIIRKELTNIYPLLCKVNPDMFVEKYLHRTLYYYLSQLKKFKNHYNESANA
DKSAVLRSIGLIGLEVGNQMATYLDAILDNIREGLSYPANSGVQSILANAVSKGDTSGAN
LSAISTTSSGSSKYRAIRKDTEPAIFDCIGKLSIAVGPALTKHLQRDILDMMFSNCSLSK
PMRDVLQTLITNIPSLTPTINKKLLNLLSLVLSGETFQPPGSPYGSLKINEAAAKEYRLM
MISRDTGLSISNILNNPETYQSLDESIAVQALKMFAFFEFENYQLNEFVRYCIIAYLDSP
SPKVRQTATSTSCKIFVKDPICHQTSVNALNAVNEVVEKLLSISITDPIAEIRLEGLKCL
DQAGEFDPQLSQAEYVKQLFVALNDEVFAIRKVAIKILGRLSNINPAYIVPSLRKTLIQL
LSRLEYANTSRKKEEAAIILSLLISNSTELARPYTKPIIEALIPRIKDSSSSVSASAISC
LGETAVVAGEDIKPFLGELMPLILGTFQDQSSSYKRDAALKALGRIASSSGYVIQPLLDY
PQLLGMLVGILKSETSPKIRRETVRLLGILGALDPYKHREVEQTSQKIPVEQNAPPVDIA
LLMQGMSPSCEEYYPTVAINNLMKILKDPSLSAHHNKVIQAVMYIFQTLGLRCVSFLPQI
IPGIINVMHNCQPSMLKFYLQQLGALILIVKQHTRPFLPEIFAVIKEFFVSPVQPNVRVI
LIHLIESISKALEGEFKMYLPEVLPLMLNLIEEDKSHDREPSIHVLRSFVVFGSNIEEYV
HVVVPTIVKMFEIGPPILKKTAIETIGKLSRTLDLNDMSSRIIHPLLRVISQGNEDLSSA
AMNTICCLALSLADDFIVFIPVIKKTLIASKTHSAMFDQIVTKMLNGDPLPTHLNLYKDY
DSHMSHFDVPDVDTPFKKLPVNQAALKAAWDSSQRNNTKEDWQEWIARLSKELLKQSPSH
AIRACAGLASDYHPLAKDLFNSSFASCWSELYSHIRRN
NT seq 3897 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaccacagctccaagtggttgatggcattgcattgaaccagattttcctcggc
ctcaaactgagtaatgaggaggatcgatcacgcagtgctatagagttacggaactttctc
gcgtccatagccagagatttgacaccagaacaatttaacaagtacaacaatgaaatcaac
aagacaatatttgatttccttcaaagcaaggataccgtacaaaccttgggtggcattgct
gctttaaatgcattgatcgattttgatagtggggtgggagaagagaatgctacaaaaact
gctcggttttcgaactacttgagctccttgattctctccaatgatcttacgattatgaaa
caagcgacaaagacactaggcaagttggccacgcccagaggaactttaacaggagacttt
gtggacttcgaggccaaaaaggcaatcgaatggctccagagtgacaaccggcagcatgaa
aatagaagacatgcagcaatattaatcatttctgcattagcagataatgcgccgttgctt
cttcaaggctatattacacagattttggagcacatttggattccattgaaggacaacaag
ctcatcattcggacagatgcagccgaaactctccaaaagtgtatgtctattctctattca
cgagacgttgaattaagaaagaaatggatcagaattttgattgatctggcatccaaaatt
cttaatgagagtggcatgaaaccaaacaacggcggctcctcttcaagttataatttgatt
tacagtgcaaatggctattcaagtgaagcgatccacggtgccctcttggtttaccgagaa
ttggtcaaatattatgaggatccgtatattaagtacatgttcgaaacgatgtacgaaaac
atcaccatatacaagaatcacaagatgtctattatccggaaagagctcacaaacatatat
ccattgctctgtaaggtgaaccctgatatgtttgtggagaaatacttgcatagaacgttg
tattactatttgtcgcagttgaaaaagttcaaaaaccactacaacgagtctgccaatgct
gacaagagtgcggtgctaagaagtattggtctcatcggtttggaagttggcaaccaaatg
gcaacatacttggacgctattttggataacatcagagagggactttcttatccagccaac
tctggcgttcagctgattttagccaatgccgtatccaaaggtgatacatcaggcgcaaat
cttagcgccatttctaccacctctctgggttcatccaagtacagggcaattcggaaagat
acagagccagctatattcgactgcattggaaagctatctattgcagtaggtccagctttg
acaaagcatttacagcgagatatattggatatgatgtttagcaattgttcgttgtcaaag
ccgatgagagatgtcttgcaaactctaatcactaatatcccatcactcaccccaaccatc
aacaaaaagctactcaatttattgagtttagtcttgtcaggcgaaacattccagccccct
ggctctccatatggcctgttgaaaatcaacgaagccgcagcaaaagaatatcgattaatg
atgatatctagagatacgggccttagcatcagtaacatcctcaataacccggaaacttat
caatctttagatgaaagcatagcggttcaggcattaaaaatgtttgcattttttgaattc
gaaaattatcaactaaatgagtttgttaggtattgcatcattgcatatttggattctcca
agtcctaaagtgcgccaaacagcaacttctacgtcatgcaaaatatttgtcaaggaccct
atttgccatcaaacaagtgttaatgcattgaatgctgtgaacgaagttgttgaaaaatta
ttatccatttctatcactgatccaatagcagaaatcagactcgaaggtttgaaatgcctc
gaccaagctggagaatttgacccgcaactttcgcaagcagagtacgtgaagcaacttttt
gttgcgcttaacgatgaggtgtttgcgattaggaaagtagcgataaagatattaggacga
ttatctaacattaaccccgcttatatcgtcccttcgcttcgaaaaactttgatacaattg
ttatcacgtctagagtatgccaatactagcagaaagaaggaagaagctgctatcatcctt
tctcttttgatttcgaattcgactgaattagctcgtccttacacaaagcctattattgaa
gcattgatccctagaatcaaggactcaagttcttctgtttctgccagtgcaatcagctgt
cttggggagacagctgttgtagctggcgaggatatcaaacccttcctcggggaattaatg
ccgttgatcttgggaacttttcaggaccaaagttcatcatacaaaagggacgcagcctta
aaggctttaggtagaattgccagttcctctggatacgtgatccaacctttgctagactat
ccacaacttttgggtatgctagtaggcatattgaagctggaaacttcgcctaaaattcga
cgggagactgttcgattgttaggtattttgggtgcattggacccatataagcatcgggag
gttgaacaaacttcccaaaagatcccggtggagcagaatgcgcctccagtggatattgct
cttttgatgcaaggaatgtctccttcttgtgaagaatattaccctactgttgccattaat
aatttgatgaagattttaaaagacccctctttgagtgctcatcacaacaaagtgattcag
gcagttatgtatatctttcaaacccttggattgagatgtgtctcgtttcttcctcaaatt
ataccaggaatcataaatgttatgcacaactgtcaaccaagtatgttgaagttctacttg
caacaactaggggcattgattttgattgttaagcaacacactcgtcctttcttacctgaa
atatttgcagtgatcaaagagttcttcgtttcccctgtgcaacctaacgtcagagtcatt
cttattcatttgatagaatccatttcgaaggcgttagaaggcgagttcaaaatgtattta
cctgaggtattaccattgatgctcaatttgattgaggaagataagtcgcatgatcgggaa
ccgtctattcatgtcttacgaagcttcgttgtctttggtagtaacattgaagagtatgtc
catgttgtcgtcccaactatagtgaagatgtttgaaattggtccacctattttgaagaaa
actgcaattgaaacaataggcaagttgtcaagaactttagatctaaatgacatgtcttcg
aggattattcatccattgctacgggtaattagccaaggcaacgaagatttatcttctgct
gctatgaacactatatgttgtttggcattgagcctagcagatgatttcattgttttcatt
ccggtgattaagaaaactttgattgcactgaagactcattcagccatgtttgaccagatt
gtgacgaaaatgctcaacggtgatccattgccaactcacctaaatttgtacaaagactac
gattcacatatgtctcactttgatgttccagatgttgatacaccgttcaaaaaattgcct
gttaaccaagcagcattaaaagcggcatgggattcatcacagaggaacaatacgaaagag
gattggcaagaatggatagcacgtttgagtaaagaactcttgaaacaaagtccatctcat
gcaataagagcttgcgcaggtctagcttcagattaccatcctcttgcaaaagacttattc
aattcgagttttgcctcttgttggagcgaactttattctcacatcaggaggaattga

DBGET integrated database retrieval system