KEGG   Clavispora lusitaniae: CLUG_04654Help
Entry
CLUG_04654        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
clu  Clavispora lusitaniae
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    CLUG_04654
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     CLUG_04654
Transfer RNA biogenesis [BR:clu03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    CLUG_04654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MSSLLFSITHVLARDSISNDMMYKRLAIGISISAILISVFKLHLPNITSPIFLARLYSHL
HIPCSMSSIPSNHPYHKELEIATLAVKRASILTKKLSDSIAATSKNGTQIKDDKSPVTVG
DYAAQAIVNHALQLNFPSDKIVGEEDSISLRDGSDEANKLNSRILQILEDAQKETASLNN
QLGDLKTIEEIHSSIDLGNYEGGPTGRFWALDPIDGTKGFLRGDQFAVCLALIEDGKVVL
GVIGCPNLAEHIVSNEEQTGRIGGLFSAVHGLGSYYSPLFESNEFVPLAKQQKLQMTEET
SPSKLKVMEGVEKGHSAHSTQSQIKRELGFDDSTVAKQTINLDSQVKYCVLAKGQADIYL
RLPINDTYREKIWDHASGNILIHESGGQVGDIRGSPLDFGKGRYLQSKGVIAANKKIFAT
VIDAVEKVLSKQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctttgttgttttccattactcacgtgctcgcacgagacctgatactgaacgat
atgatgtacaaacgattggctataggtatatcgataagtgcaattttgatctcagttttc
aagcttcatttacctaatatcacgtcaccgatatttttggctcgcctatattcacatctt
cacattccttgttccatgtccagcatcccctcaaatcatccttatcacaaggagttggaa
atcgcaaccttagcagtcaaaagagcttcaattcttacaaaaaagctaagcgattcaatt
gcagctaccctgaaaaacggcacccagataaaagacgataaatcccctgtaactgtgggt
gattatgctgctcaagctatcgtaaaccatgcacttcaattgaactttccatccgataag
attgttggcgaagaagattccatttctttgcgtgatggatctgatgaagcaaataaattg
aatagtcgtattcttcaaatcctagaggatgcccagaaagaaactgcctccctcaacaat
caattgggcgacctcaaaactattgaagaaattcattccagtattgatttaggaaactat
gaaggcggaccaactggtagattttgggcattggaccctatcgatggaacaaagggattt
ttgagaggagatcaatttgctgtttgccttgcactaattgaggacggcaaagtcgtcctc
ggtgtaataggttgtccaaacttggctgaacatatcgtctctaatgaagaacagacaggc
agaataggaggtttgttttctgccgttcacggcttgggatcttactactcgcctttattt
gaatcgaatgagttcgtcccccttgctaaacaacaaaaacttcagatgactgaagagact
tcgccatcaaaattaaaagtgatggaaggagtggaaaagggccactcagcccactctacg
cagagccaaatcaagcgggagttaggctttgatgattcgacagtggcgaaacaaacaatc
aacttagattcacaagtcaagtactgcgttttagcaaagggacaagctgacatttacttg
cgcttacctatcaatgacacttatagagaaaagatttgggatcatgcttcgggtaacatt
ttgattcatgaaagtggaggtcaagtaggcgacatcaggggaagtccgttggattttggt
aaaggaagatacttgcaatccaaaggtgtcattgctgctaacaagaagatttttgctact
gtcattgatgctgttgaaaaagttttaagtaagcagtaa

DBGET integrated database retrieval system