KEGG   Clavispora lusitaniae: CLUG_04654Help
Entry
CLUG_04654        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
clu  Clavispora lusitaniae
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:clu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 432 aa AA seqDB search
MSSLLFSITHVLARDSISNDMMYKRLAIGISISAILISVFKLHLPNITSPIFLARLYSHL
HIPCSMSSIPSNHPYHKELEIATLAVKRASILTKKLSDSIAATSKNGTQIKDDKSPVTVG
DYAAQAIVNHALQLNFPSDKIVGEEDSISLRDGSDEANKLNSRILQILEDAQKETASLNN
QLGDLKTIEEIHSSIDLGNYEGGPTGRFWALDPIDGTKGFLRGDQFAVCLALIEDGKVVL
GVIGCPNLAEHIVSNEEQTGRIGGLFSAVHGLGSYYSPLFESNEFVPLAKQQKLQMTEET
SPSKLKVMEGVEKGHSAHSTQSQIKRELGFDDSTVAKQTINLDSQVKYCVLAKGQADIYL
RLPINDTYREKIWDHASGNILIHESGGQVGDIRGSPLDFGKGRYLQSKGVIAANKKIFAT
VIDAVEKVLSKQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctttgttgttttccattactcacgtgctcgcacgagacctgatactgaacgat
atgatgtacaaacgattggctataggtatatcgataagtgcaattttgatctcagttttc
aagcttcatttacctaatatcacgtcaccgatatttttggctcgcctatattcacatctt
cacattccttgttccatgtccagcatcccctcaaatcatccttatcacaaggagttggaa
atcgcaaccttagcagtcaaaagagcttcaattcttacaaaaaagctaagcgattcaatt
gcagctaccctgaaaaacggcacccagataaaagacgataaatcccctgtaactgtgggt
gattatgctgctcaagctatcgtaaaccatgcacttcaattgaactttccatccgataag
attgttggcgaagaagattccatttctttgcgtgatggatctgatgaagcaaataaattg
aatagtcgtattcttcaaatcctagaggatgcccagaaagaaactgcctccctcaacaat
caattgggcgacctcaaaactattgaagaaattcattccagtattgatttaggaaactat
gaaggcggaccaactggtagattttgggcattggaccctatcgatggaacaaagggattt
ttgagaggagatcaatttgctgtttgccttgcactaattgaggacggcaaagtcgtcctc
ggtgtaataggttgtccaaacttggctgaacatatcgtctctaatgaagaacagacaggc
agaataggaggtttgttttctgccgttcacggcttgggatcttactactcgcctttattt
gaatcgaatgagttcgtcccccttgctaaacaacaaaaacttcagatgactgaagagact
tcgccatcaaaattaaaagtgatggaaggagtggaaaagggccactcagcccactctacg
cagagccaaatcaagcgggagttaggctttgatgattcgacagtggcgaaacaaacaatc
aacttagattcacaagtcaagtactgcgttttagcaaagggacaagctgacatttacttg
cgcttacctatcaatgacacttatagagaaaagatttgggatcatgcttcgggtaacatt
ttgattcatgaaagtggaggtcaagtaggcgacatcaggggaagtccgttggattttggt
aaaggaagatacttgcaatccaaaggtgtcattgctgctaacaagaagatttttgctact
gtcattgatgctgttgaaaaagttttaagtaagcagtaa

DBGET integrated database retrieval system