KEGG   Clavispora lusitaniae: CLUG_04703Help
Entry
CLUG_04703        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
clu  Clavispora lusitaniae
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CLUG_04703
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     CLUG_04703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 330 aa AA seqDB search
MITVIGSLNYDLVTYTDKVPEAGETFQANAFENHHGGKGLNEALACAKLRSSDKTVVKMI
GNVGSDTFGKELRHSLEQANVDTTFVKTLDNQSSGVAVILVESSGENRILITAGANGELK
PTEEDFRTYFKDSHAAGDFLVLQNEFPFTLQTIEWVKANKPSINIAYNPSPFYEELMTPE
LMSKIDLIILNEGEALSVATNVLSKSDITDFKSTIASNAVKGFSQLAEKLKSMIGKDNCN
TVIITMGSKGAIYTSHEDTAMFQPALQVTNIVDTTGAGDTFFGAVVSHLSEGKSLEKAIE
FATTASGLAIQKKGAAEGIPSYDEVKEASN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccgttatcggatcacttaactacgacttggtcacatacacagacaaagttcct
gaggcaggagaaacattccaagcgaatgctttcgagaatcaccatggagggaagggcttg
aatgaagctttggcttgtgccaagttgcgcagttccgacaagaccgttgtgaaaatgatt
ggcaatgtaggttctgatacttttgggaaagagttaagacactctctcgaacaggccaat
gtcgacaccacgtttgtgaagacattggataaccaatcttctggtgtggcggtgatcttg
gttgagagttcgggtgagaaccgcattttgatcactgctggagccaatggtgaattgaag
cctactgaagaggatttccgtacttatttcaaggacagccatgctgctggggatttcctt
gtcttgcaaaatgagttcccctttacacttcaaaccatcgaatgggtgaaggcgaataaa
ccatcaatcaacatcgcatacaacccctcacctttctacgaggaactcatgacacccgag
ctaatgtcgaaaattgatttgatcattcttaatgaaggtgaagctcttagcgttgccact
aatgtgttgagcaagtctgatatcactgatttcaagtccaccattgcgtctaatgcagtg
aaaggcttctcacaattagccgagaaactaaaatccatgatagggaaagacaactgtaat
acagtgataattacgatgggtagcaaaggtgcaatttacacaagccacgaggacacagcc
atgtttcaacccgctctacaggtgacaaatatcgttgacacaactggtgctggtgacaca
ttttttggagcagttgttctgcaccttagtgaagggaagtctttggaaaaggctatagag
ttcgctacaacagccagcggcctcgcaatccaaaagaaaggagcggcagaagggattcct
tcttacgatgaggtaaaagaagcaagtaattaa

DBGET integrated database retrieval system