KEGG   Clavispora lusitaniae: CLUG_04742Help
Entry
CLUG_04742        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K03128  
transcription initiation factor TFIID subunit 2
Organism
clu  Clavispora lusitaniae
Pathway
Basal transcription factors
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CLUG_04742
Peptidases [BR:clu01002]
 Metallo Peptidases
  Family M1
   CLUG_04742
Transcription machinery [BR:clu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     CLUG_04742
   Coactivators
    SAGA/TFTC/STAGA complex
     CLUG_04742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1698 aa AA seqDB search
MSSFDVFSCVALPSVVRAHPCTTGKTKLHQLPSITQSKPMSSINLHERQQSEGPTPKAFG
GISGTPKAKSNRARHINLSTQALKVAHQRVSLNVDLARRKVIGSTEITIIPTSNSLRVVR
LDCREMKIRRVFINGSGSTNYLHNDLLYVNDPARFEHSVKANTVNVSDIFSPTFGINQHH
LLRQKLNYIFGTISPDQISSDQVDNTNTEELAIILPENLKLELTDLNSLHTPSVDVPATG
LTPFHMRSKSTHNDIYTPIQITVEYELCNPKSGLNFVCQSEDKNLWHAYTVNSEYNISTS
SWVPCIDNLWERCTWSIDISIPRTVKDIEDPNEEERRTLEAQKETRNGKVGSIDDNGRNE
EKESEDKNEDEHRNENEKIDSDNGYHNDNNDNNNEGGDDDDNDDDDDDDDDDDTENFDLF
VCTGDFNNLKEMPHGSDPRKKVVSWSIFNPVCAHHVGWAVGPFQSKELSDFNEATAGVTE
QDESLGEFEEIEKDESTSSMMLYFLPGYEDLVTNTCVFAHKALDFFSKEFGSYPFGSFCI
TFVSGPAYPYHNFAGLSIMSDKKLYPADVIEPMFSVTEEILECIASQWSTINIVPQVFND
IWCTIGIAKYMSFQFIKTLVGSNEFRYQIKTKMDQIVEQDVNKKPLGMQAYNFPISESDL
SFVRLKAPVILFILDRRMTKTDKSFGLSRVLPKIFLQAMSGDLQNGTLSTQHFQYVCEKV
NRNRLESFFKQWVYGIGTPIFNITQRFNKKRSMIEVTIRQTQSQQPKNVHPQAETFIEDS
LTYLNDTPIYPVQQTFLGPMTIRVHEADGTPYEHIVDIKDSVVKFDVQYNTKFRRLKKNK
DENSESTPIFAKLGDVLQSEQEMQDWNLADWPKRDEEFLDPFEWIRVDTDFEWIARFNVK
QPDYMFGAQLQQDRDIEAQIAAIEYFGSQEKPNTIYCTSLLRTLMDSRYFYGVRIAAAKS
LAIISKSNNNFAGLGYLIRAFKELYCFENSSVPFSNSFDDFGKLFLQKAIPRFLGSIKDD
DGNTPQSIKSLLFNVLKYNDNSNNEFQDCYYVSDLIWSLTEALIPANSEQLNVDFHLERE
KAEASYSKDAKFIQKVVEEFSRIQKLDGWVPSYQSVVSYACIEQKIRLARTNLIDISLED
LLFLTFKKYSPDIRALAFKGLFVLGGLKNAQILKYFMEVYLLEDSTMYFKSLLINALVSS
ISEAAVNGTPSMLDDPEFRSLEKIFESGGGISNQTTNMVVIEESTHTAEMDTRRDVLAKA
TIKGTIEILRRDYSIGKGLMKTMWELLHTSLISILDRRKVFLLCEILYEEIDSFPVIISV
PCVPFEELKKKIVAKHLGDGKVVIKREGRFKIQLSAKISLNDNKKMNKKEPTRLPSARVS
KTARSRVDPEEEKSEENSKLKLRLAPSVLSDTSVPASLLPEPSRKDIPSEVKNDPATTAP
SESHSVKRTGEDDMTLTFKFKKRKLDSPEMTSSNVASSIVTIHNSQVKIRFSNPKKLSTP
QTSNEMRYVKISTKTGSVSLSATPFAESPETRSSTTPRISMSPKKKMNGKITERSNGNND
RTIYKDAKSKNEARNSDGGNLSEPAEVVSTEKVRSSDDSEVEVKVKKENSDSAKSVSRSS
SKVSSRSSSEETREFSRAASPFSGEQSSAPKRKKTKIYIHGHTSETPSPPQSRAATPVKT
EESADSEKPKLKLKLTLN
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctttcgatgtattctcttgtgtagcacttccctctgttgtacgcgcgcacccg
tgcaccacaggcaaaaccaagttacaccaacttccatcaataactcagtcaaaacccatg
ctgtcgatcaatttacatgaacgtcagcagctggagggccccactccgaaagcttttggt
ggaattagcggaactccaaaggccaagtccaaccgggctcgacatatcaatctttctacc
caagcactaaaagtggcccatcaacgagtgagtttgaatgtggatttggccaggcgaaaa
gtcattgggctgacggaaattaccattatccccacgtccaactctcttcgtgtggtacgc
ctagattgtcgtgaaatgaaaatccgccgtgttttcatcaacggttccggactgaccaac
taccttcataatgacttactctacgtcaacgatccagcccgctttgagcattccgtgaaa
gcaaatactgtgaatgtttctgacatatttagcccgaccttcggcattaaccagcatcat
ttgttacgccagaaactaaactacatctttggtactatctctccagaccaaatctcgtca
gatcaagtcgacaacacgaacactgaagagcttgcaattattcttcccgagaacttaaag
cttgaactcacagatttgaattcgttgcatacgccctctgttgacgtacctgcaactggt
ctaactccgttccacatgcgctccaaaagtacacataatgatatctatacacccatccag
attacagtggagtatgagctttgcaaccctaaaagtggccttaactttgtgtgccaatcg
gaggacaaaaacctttggcatgcttacaccgtcaattccgaatataacatttcgacatct
tcatgggttccgtgcattgataatctctgggaacgttgcacctggtctattgacataagt
atacctcgtacagtcaaggacatagaggacccaaatgaggaagaacggagaactttagag
gctcaaaaggaaacgcgaaatggaaaagttggctccattgatgacaatggccgtaatgaa
gagaaagagagcgaagacaagaatgaagatgagcatagaaatgaaaacgaaaaaattgat
agcgacaatggttaccacaatgataacaatgataacaataatgaaggtggtgatgatgac
gacaacgatgatgatgacgatgacgatgatgatgacgatacagaaaatttcgatttattc
gtttgcacaggagattttaacaatttgaaggaaatgccccacggatcggatccaagaaaa
aaagtggtttcttggtccattttcaatcccgtttgtgcacaccatgttgggtgggcagtc
ggacctttccaaagcaaggagctttctgattttaacgaagcaactgcaggtgtaacagaa
caagatgaatctttgggggagtttgaagaaattgaaaaggatgagtctacactgtcgatg
atgttatatttcttgccaggatatgaagatttagtgacgaatacctgtgtttttgctcac
aaagcgctagatttttttctgaaagaatttggatcctatccatttggatccttctgcatc
acctttgtgtctggtccagcttatccatatcacaactttgctggattgtctattatgagc
gacaaaaaattgtatccagctgatgttatcgagcctatgttctctgttactgaagaaatc
ttggaatgcatagctagtcaatggtctactatcaacattgtaccacaggtgttcaatgat
atatggtgcacaattggtatcgcaaagtacatgagtttccagtttattaaaacgcttgtg
ggatccaatgaattcaggtaccaaatcaaaacaaaaatggaccaaatagttgaacaggat
gttaacaagaaaccactaggaatgcaagcttacaactttcctatctctgagtctgacctt
tcatttgtgcgtctcaaggcgccagtcatactatttatccttgacagaagaatgacgaag
acagataaatcatttggtctctcaagagtgttacccaaaatattcttgcaggctatgtca
ggcgatctacagaatggtacgctttcaactcaacattttcaatatgtgtgtgagaaagtg
aacagaaatcgcttggaatcgtttttcaaacaatgggtttacggtataggtactccaatc
ttcaatattacccagagattcaacaagaaaaggtctatgatcgaggttacgattagacag
acgcaactgcaacaacccaaaaatgtacaccctcaagcagaaactttcattgaggactca
ctcacatatttgaacgatacaccaatttatcctgttcaacaaacttttttgggccccatg
acaattcgtgttcatgaagcggacggtacaccttacgaacacatcgttgatatcaaggat
agtgttgtaaaatttgacgttcaatacaacacaaagttcagacgtctcaaaaagaacaag
gacgaaaatagtgaaagcacccccatttttgccaagttgggggatgttcttcaaagcgaa
caggaaatgcaagattggaaccttgcagattggccaaaacgagacgaagagttcctcgat
ccatttgaatggattcgtgttgataccgattttgaatggattgctagatttaatgtgaaa
caacctgactacatgttcggagctcagttacagcaagaccgtgatattgaagcccaaatt
gcagcaatcgaatattttggctctcaggagaagcctaatactatttactgtacactgttg
cttagaaccttgatggacagcagatacttttatggagtaaggatcgcagctgcaaaatct
cttgccatcatttctaaatctaataacaatttcgctggccttggctacttgataagagcg
ttcaaagagctttactgctttgagaatagttcagtgccattcagcaattcctttgatgat
tttggtaagctctttttgcaaaaggcaatccccagatttttagggctgattaaggatgat
gatggaaacacaccgcaaagtatcaagtctttgttgtttaatgttttgaagtataatgat
aattctaataatgagttccaggactgctattatgtgtcggacctcatttggtctttgacc
gaagctttaattcctgccaattcagagcagttgaatgttgactttcatttggagagggag
aaagccgaagcatcgtactccaaagatgcaaagttcatccaaaaagttgtcgaggaattt
tcaaggatacaaaaattggatggttgggttccatcgtatcaatcagttgtctcttatgct
tgcattgaacaaaaaattcgcttagcacggaccaatcttattgatatttcattggaggat
cttttattcttgactttcaagaagtattcgcccgacatcagagccttagcgttcaaaggt
ttatttgtcttaggaggtttgaaaaatgcccaaattttgaagtactttatggaggtttac
ttgcttgaagattcgaccatgtacttcaaaagtctcttgataaatgcacttgttctgtct
ataagtgaagcagcagtgaatggaactccctcgatgcttgatgaccctgaattcagatca
ttggagaaaatatttgaaagtggcgggggtatatctaaccaaactacaaatatggttgtt
attgaagaatcgacacatacagcagaaatggatactcgccgagacgtgttggcaaaagca
acaattaaaggaacaatcgaaattcttcgcagagattactctatagggaaaggacttatg
aaaacgatgtgggaattacttcatacatctcttatcagtatacttgacaggaggaaggtt
ttcctcttatgtgagattttgtacgaggagatcgattcgttcccagttattatttcagtg
ccatgtgttccttttgaagagctcaagaaaaagattgtggcaaaacatttgggtgatgga
aaagtagtcattaaacgagagggcagattcaagattcagttgagtgctaagatactgttg
aacgacaacaagaaaatgaataagaaagagcctacccgtcttcctctggctagagtttcc
aaaactgcaagatcacgagttgacccggaagaggaaaaactggaggagaattcgaaactc
aaactaaggttagctccttctgtgctctctgatacctctgtcccagcatctctcttacct
gaaccaagtcgcaaagatattccttcggaagttaaaaatgaccctgcaacgaccgctcct
tcggagtcgcatctggttaagagaacgggagaagacgatatgacattaaccttcaaattc
aagaaacgaaagttggatctgccggagatgacatcgtctaatgttgcctcactgatagta
actatccacaattcacaagtcaaaattcgttttctgaacccgaaaaagttaagcactccc
caaacctcgaacgaaatgagatatgtgaaaatttcaaccaaaactggcagtgtctcatta
tcagctacaccctttgccgaatcaccagaaacacgcagttctactactccaagaatctcg
atgtcacctaagaaaaaaatgaatggaaaaattacagaacgctcaaatggaaataatgac
agaaccatatacaaggatgctaaatctaaaaacgaggcgagaaattcggatggagggaat
ttactggaacctgcagaggttgttagcacggaaaaggtacgcctgagtgatgattctgaa
gtggaagtaaaagtgaaaaaggaaaattctgattcagcaaaaagtgtttcacggtctctg
tcaaaagtttcttctcgctcctcgctggaggaaacacgagaattttcacgagctgcaagt
cccttctctggtgaacagtcttcagctccgaaacgtaaaaagacaaagatctacattcat
ggtcatacatcagaaacaccatctcccccacaatcaagagcagctacacccgttaaaacc
gaggagtccgccgatctggaaaagcctaagttgaagttgaaactcacgttgaattaa

DBGET integrated database retrieval system