KEGG   Clavispora lusitaniae ATCC 42720: CLUG_04758Help
Entry
CLUG_04758        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00600  Sphingolipid metabolism
clu01100  Metabolic pathways
Module
clu_M00094  Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CLUG_04758
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CLUG_04758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 8496437
NCBI-ProteinID: XP_002615876
UniProt: C4Y981
AA seq 360 aa AA seqDB search
MGFLSYIDKNQIQISTKLLLGLYGLDYISSKYSPTIHSITSKFLHLQPNTQYGSDFYDID
VSDSFCVAYWVVLLTFLRSTLMQCCFMPVAKRLCGIQSKKAKVRFAEQSWSVVYYCVSFA
LGFYLYYHSPYWNDLDHIFIGWPHDHMSPLLKKYYLVSIAFWLQQVLVLNIEERRKDHVQ
MFSHHIITCALVIGSYYYYFNRIGNLILIIMDSVDIFLSTAKVLKYSGFSRICDVMFLFF
LVSWVILRHGVYNYLFYHSWKYSTILMKDSQCIPGLQQKRCWTPTIINTFLVLLGGLQFI
TCIWMYLILKVALKVIRGQSAEDVRSDADDTDVEEQTGQEDSREGTDSSVETITEMDEKN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctatcatatatcgataagaatcagatccagatatccacgaagcttctactt
gggctatatgggttggactacatcagttccaagtattctccaacgatccattcgattacg
tcaaagtttttgcatttacaaccgaatacccagtacggttctgacttttatgatattgat
gtcagtgattcattttgtgtggcatattgggtagtgttacttacgtttttgagatctaca
ttgatgcaatgttgtttcatgcctgttgccaaacgcctctgtggcattcagtcgaaaaaa
gcaaaggtccgctttgcggaacaaagttggtctgttgtctactattgtgtctcgtttgct
cttgggttttacctttactaccactcaccatattggaatgatttggaccatattttcatt
ggatggcctcacgaccacatgtctccacttctcaagaaatattacttggtatcgattgca
ttctggttacagcaagtgttggttttgaatatcgaagaaaggaggaaagaccacgtgcag
atgttcagtcatcatataattacctgtgcattagtgattggttcctattattactacttc
aaccgcattggaaatcttattttgatcatcatggactctgtcgatatatttttgtccaca
gccaaagtcctcaagtattcaggtttcagccgcatatgtgatgttatgttccttttcttt
cttgtctcgtgggttattttacgccatggtgtgtataattacttgttttatcactcatgg
aagtactccacaattttgatgaaagattcacaatgcattcccgggttacaacaaaaacga
tgctggactcctactatcatcaacacctttctcgttttactaggaggcttgcaatttatc
acttgcatttggatgtatttgatcctaaaggttgcattgaaagtgattagagggcaaagc
gctgaggacgttagaagcgatgcggatgacacagatgttgaagaacaaactggacaggaa
gactcaagggaaggtacagattcatcggttgaaacaatcaccgagatggatgagaaaaac
tag

DBGET integrated database retrieval system