KEGG   Clavispora lusitaniae: CLUG_04758Help
Entry
CLUG_04758        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
clu  Clavispora lusitaniae
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Ceramide biosynthesis
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CLUG_04758
Enzymes [BR:clu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     CLUG_04758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 360 aa AA seqDB search
MGFLSYIDKNQIQISTKLLLGLYGLDYISSKYSPTIHSITSKFLHLQPNTQYGSDFYDID
VSDSFCVAYWVVLLTFLRSTLMQCCFMPVAKRLCGIQSKKAKVRFAEQSWSVVYYCVSFA
LGFYLYYHSPYWNDLDHIFIGWPHDHMSPLLKKYYLVSIAFWLQQVLVLNIEERRKDHVQ
MFSHHIITCALVIGSYYYYFNRIGNLILIIMDSVDIFLSTAKVLKYSGFSRICDVMFLFF
LVSWVILRHGVYNYLFYHSWKYSTILMKDSQCIPGLQQKRCWTPTIINTFLVLLGGLQFI
TCIWMYLILKVALKVIRGQSAEDVRSDADDTDVEEQTGQEDSREGTDSSVETITEMDEKN
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctatcatatatcgataagaatcagatccagatatccacgaagcttctactt
gggctatatgggttggactacatcagttccaagtattctccaacgatccattcgattacg
tcaaagtttttgcatttacaaccgaatacccagtacggttctgacttttatgatattgat
gtcagtgattcattttgtgtggcatattgggtagtgttacttacgtttttgagatctaca
ttgatgcaatgttgtttcatgcctgttgccaaacgcctctgtggcattcagtcgaaaaaa
gcaaaggtccgctttgcggaacaaagttggtctgttgtctactattgtgtctcgtttgct
cttgggttttacctttactaccactcaccatattggaatgatttggaccatattttcatt
ggatggcctcacgaccacatgtctccacttctcaagaaatattacttggtatcgattgca
ttctggttacagcaagtgttggttttgaatatcgaagaaaggaggaaagaccacgtgcag
atgttcagtcatcatataattacctgtgcattagtgattggttcctattattactacttc
aaccgcattggaaatcttattttgatcatcatggactctgtcgatatatttttgtccaca
gccaaagtcctcaagtattcaggtttcagccgcatatgtgatgttatgttccttttcttt
cttgtctcgtgggttattttacgccatggtgtgtataattacttgttttatcactcatgg
aagtactccacaattttgatgaaagattcacaatgcattcccgggttacaacaaaaacga
tgctggactcctactatcatcaacacctttctcgttttactaggaggcttgcaatttatc
acttgcatttggatgtatttgatcctaaaggttgcattgaaagtgattagagggcaaagc
gctgaggacgttagaagcgatgcggatgacacagatgttgaagaacaaactggacaggaa
gactcaagggaaggtacagattcatcggttgaaacaatcaccgagatggatgagaaaaac
tag

DBGET integrated database retrieval system