KEGG   Clavispora lusitaniae: CLUG_04779Help
Entry
CLUG_04779        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
clu  Clavispora lusitaniae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    CLUG_04779
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CLUG_04779
Enzymes [BR:clu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     CLUG_04779
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     CLUG_04779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1764 aa AA seqDB search
MARLSAPISPPMESTGDRLMTLETQDGHALQGYSFGAPVSAAGEVVFQTGMVGYPESITD
PSYEGQILVITYPLVGNYGVPDRNLKCDIVEELPKYFESNRIHIAGLVVAHYTEEYSHYL
ATSSLGQWLQKEGIPAMYGVDTRGLTKKLRTEGSTLGRMAIQSANSKHDEVVGQENWAPF
FDVPQWDDPNVKNLVAKVSTKEPVLYKPKTNVKTDKNGKPIRIVAVDVGMKYNQIRCFVA
RGVELKVVPFDYDYTNEEYDGLFVSNGPGDPQVMTDAVSRLEKVMKEGKTPVFGICLGHQ
LLARATGASTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDSKTLADGWKELFVNAN
DGSNEGIYHESKPFFSVQFHPESTPGPRDTEFLFDVFINAVVDFKNTGVYKPVQFPGGLL
ADNRAAHPRENVKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTVLINPNIATIQ
TSKGLADKVYFLPVNPEFVRKVIEHERPDGIYCTFGGQTALSVGIALKDEFESLGVKVLG
TPIDTIITTEDRELFASAMEEINEKCARSEACSTVEEAVNAANAIGYPLIVRAAYALGGL
GSGFADNEAELVALCQKAFATSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCNMENFDP
LGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEV
NARLSRSSALASKATGYPLAYTAAKLGLNIPLNEIKNSVTKSTCACFEPSLDYVVVKIPR
WDLKKFTRVSSLLSSSMKSVGEVMSIGRTFEEAIQKAIRSTDYQNLGFNSTAALMSIDID
TELQTPSDQRLFAIANALTDGYSVDKVWQLTNIDKWFLNKLDGLIKFGKKIADFGSKEKL
PVPVLRQAKQLGFEDRQIAKFLDSNEVAIRRMRKEAGVIPFVKQIDTVAAEFPAFTNYLY
VTYNADSSDVDFEDHGVIVLGSGVYRIGSSVEFDWCAVRAIRTLRENKIKTIMINYNPET
VSTDYDEADRLYFETINLERVLDIYDLEQSSGVVISMGGQTSNNIALTLHRQNVKIFGTS
PEMIDSAENRYKFSRMLDKIGVDQPAWKELTSIADAEEFAEKVTYPVLVRPSYVLSGAAM
NTVYSKADLASYLSQAVDVSPDYPVVITKYIENAKEIEMDAVAKDGQMIMHVVSEHVENA
GVHSGDATLIVPPQDLDPETVRRIVEATAKIGKALDITGPYNIQFIAKDNDIKVIECNVR
ASRSFPFISKVVGTDLIEMATKAIMDLPVTPYPGKKLPEDYCAVKVPQFSFSRLAGADPI
LGVEMASTGEVATFGRNKYEAYLKSLISTGFKLPKKNILFSIGSYKEKQELLPSIKKLHE
LGYTLFATAGTADFIKEHDIPVRYLEVLKDSDDQKSEYSLTQHLANNLIDLYINLPSSNR
FRRPASYMSKGYESRRMAVDYSVPLVTNVKCAKLLVEALARNISLDVSNNDAQTSHDTAE
LPGLVNITSFVPSLNDFEATTKASLAAGFTFNSFLPQTVAGSTVVDVESLADALELASES
AYTDYSLSISGSATNAEEAASAANAGSLFLPFNELANSKVSAVSAHFASWPASKPMITDA
KATDLASVLLLASLHNRSIHITGVSSEEDLELIKMAKAKDLQVTCDVAVYSLFLSKNNYP
QFNFLAFSRGPRCLVGRFGTHRSLLCWCLALFGCQGIGPRYYTWFGFEGDFAIVVFCCQR
RKTHYRKTIILRLHNKSNQDTPPS
NT seq 5295 nt NT seq  +upstreamnt  +downstreamnt
atggctagattgtctgctccaatttcccctccaatggaatctaccggtgaccggttgatg
actttggaaacccaagacggccatgccttgcaaggttactcttttggtgccccagtctct
gctgccggtgaagttgttttccagaccggaatggtgggttaccctgaatccatcaccgac
ccttcctatgagggtcaaattttggtgatcacctacccacttgtgggtaactatggtgtt
cccgaccgtaacttgaagtgtgacattgttgaggagttgccaaagtacttcgagtcgaac
agaattcatattgctggtttggttgttgctcactacaccgaggagtactctcactacttg
gccacttcctctttgggtcaatggttgcagaaggagggtattcctgccatgtatggtgtt
gataccagaggtttgaccaaaaagttgagaactgagggttctaccttgggtagaatggcc
atccaatctgcaaactctaagcatgatgaagttgtgggccaagaaaactgggccccattc
tttgacgttccccaatgggacgatccaaacgttaaaaacttggtggcaaaggtttcgacc
aaagaaccagttttgtacaagccaaagaccaatgtcaagaccgacaagaatggtaagccc
attcgtattgttgctgtggacgttggtatgaagtacaaccaaatccgttgttttgtcgcc
agaggcgttgaattgaaggttgtgccttttgattacgactacaccaatgaagaatacgat
ggtttgtttgtctccaatggcccaggtgatccacaagtgatgacagatgctgtttccaga
ttggaaaaagtgatgaaagaaggaaagactccagtcttcggtatttgtttgggtcaccag
ttgttggctagagctactggtgcttctactttgaagttgaagtttggtaaccgtggacac
aacattccatgtacttctaccatctcgggaagatgctacattacttcgcaaaaccacggt
ttcgcagttgattccaagactttggccgacggctggaaagaattgttcgtcaacgccaac
gacggctccaatgaaggtatttaccacgagtcgaagcctttcttctccgtgcaattccac
cctgaatccacccctggcccaagagataccgaatttttgttcgacgtcttcattaatgca
gttgttgacttcaagaataccggagtttacaagcctgtgcaattcccaggtggcttgctt
gcagacaacagagctgctcatccaagagaaaatgtcaagaaggttcttgtcttgggttcg
ggtggtttgtctattggtcaagctggtgagttcgactactctggttctcaagccatcaag
gctttgaaggaggaaggtatctacactgttttgattaaccccaacatcgctactatccaa
acatccaagggtttggctgacaaggtttactttttgcctgtcaaccctgagtttgtgaga
aaggtgattgagcatgaacgtccagacggtatctactgtacttttggtggtcaaactgct
ttgagtgttggtatcgccttgaaggacgagtttgaatccttgggtgtcaaggtcttgggt
actccaatcgacacaatcattaccactgaggacagagaattgttcgctagtgctatggag
gaaatcaacgaaaagtgtgccagatctgaggcctgctctactgttgaagaagctgttaat
gccgcaaatgccattggttacccattgatcgttagagctgcttacgccttgggtggtttg
ggctctggtttcgctgacaatgaagcagagttggtagccttgtgtcaaaaggcttttgct
acatctcctcaggttcttgttgaaagatccatgaagggttggaaggaagttgaatacgaa
gtcgttcgtgatgcttttgataactgtatcactgtttgtaacatggagaactttgatcct
ttgggtatccacactggtgactctattgtggtcgctccatctcaaactttgtcggacgag
gactacaacatgttgagaactactgctgttaacgttatcagacacttgggtgtggttggt
gaatgtaacattcagtatgctttgaacccattctccaaagagtactgcattatcgaagtt
aatgctagattgtctcgttcttctgctttggcctctaaggctactggttacccattggct
tacactgctgctaagttgggtttgaacatcccattgaacgagatcaagaactctgttacc
aagtctacttgtgcatgtttcgaaccttccttggattacgttgtcgttaaaattccaaga
tgggatttgaagaagttcaccagagtttcttccttgttgtcttcttccatgaaatccgtc
ggtgaagtcatgtccattggcagaactttcgaagaagccattcaaaaggcaatcagatcc
accgattaccaaaacttgggtttcaactctactgccgctttgatgtctattgacattgac
actgaattgcaaacaccttccgaccaacgtttgtttgctattgccaacgctttgactgat
ggttacagtgttgacaaggtttggcaattgactaacattgacaaatggttcttgaacaaa
ttggacggtttgatcaagtttggtaagaagatcgccgactttggctctaaagaaaaattg
ccagtcccagtgttgagacaagctaagcaattgggattcgaggacagacaaattgccaag
ttcttggactctaacgaagttgccatcagaagaatgagaaaggaagctggtgtcatccca
tttgtgaaacagattgatactgttgctgctgagttcccagccttcacaaactacttgtat
gtgacttacaacgctgactcttccgatgtggacttcgaggaccacggtgttattgttttg
ggttctggtgtttacagaatcggatcttccgtcgagttcgattggtgtgctgtcagagcc
atcagaactttgagagaaaacaagattaagacgatcatgatcaactacaacccagaaacc
gtttctactgattacgacgaggcagacagattgtacttcgaaactatcaacttggaaaga
gtgttagatatttatgacttggaacaatcttctggtgttgtgatttctatgggaggtcaa
acctctaacaacatcgccttgactttgcaccgtcaaaacgttaaaatctttggtacctct
ccagaaatgatcgactctgctgagaacagatataaattctccagaatgttggacaagatt
ggtgtcgaccagcctgcttggaaagaattgacttccattgctgatgcagaagagtttgct
gaaaaggttacctacccagtgttggtccgtccatcgtacgtcttgtccggtgctgccatg
aacaccgtttactctaaggctgatttggcttcctacttgtcgcaggctgtggatgtttct
ccagactacccagttgttatcaccaagtacattgagaacgccaaagaaatcgagatggac
gctgtcgccaaggacggtcaaatgatcatgcatgttgtttctgaacacgtcgaaaatgcc
ggtgttcactccggtgatgctactcttatcgttcctcctcaagacttggatccagaaact
gtccgcagaattgttgaagctactgctaagatcggaaaggccttggacatcactggtcct
tacaacattcaattcattgctaaggacaatgacattaaggtcatcgaatgtaacgtgcgt
gcatctcgttctttcccattcatttccaaggttgtcggaaccgacttgatcgaaatggct
acgaaggccatcatggaccttccagtaactccatacccaggaaagaaattgcctgaggat
tactgtgctgtcaaggttccacaattttctttctcgagattggctggtgctgacccaatt
ttgggtgtcgagatggcttctactggtgaagtggccactttcggaagaaacaagtacgag
gcttacttaaaatcgttgatttccaccggattcaagttgccaaagaagaacattttgttc
tctattggttcatacaaggagaaacaagagttgttgccttccattaagaaattgcacgag
ttgggctacactttgtttgccacagctggtactgctgatttcatcaaggagcacgacatt
cccgtccgctacttggaagtgttgaaagacagcgatgaccaaaaatccgagtactcgttg
actcaacacttggctaacaacttgatcgacttatacatcaacttgccatcttcgaacaga
ttccgtcgtccagcatcttacatgtccaagggatacgaatctcgtcgtatggctgtcgac
tactctgtgccattggtgactaacgtcaagtgtgctaagttgttggttgaagcattggct
agaaacatctctttggatgtcagcaacaacgatgctcaaacctcacacgacacggccgag
ttgccaggtttggtgaacatcacatcgtttgttccatctttgaacgactttgaggctacc
accaaggcttccttggctgccggtttcaccttcaactctttcttgcctcaaactgtggct
ggatcaactgttgtggacgttgaatctttggctgatgctcttgagttggcttccgagtcg
gcatacactgactattcgttgtcaatttcgggatcagccaccaacgccgaggaagctgct
tcagctgctaacgctggctctttgttcttacctttcaacgagcttgcaaactccaaggtt
tctgctgtttcggctcactttgcttcttggcctgcttccaagccaatgatcaccgacgca
aaagctacggatttggcttcggttttgttgttggcttctttgcacaacagatccatccat
atcactggtgtttctagcgaagaggacttggaattgatcaagatggccaaggctaaggat
ttgcaagtgacatgtgacgttgccgtttattctttgttcttgtctaaaaacaactaccca
caattcaacttcttggccttctcaagaggaccaagatgccttgtgggccggtttggaaca
catcgactgcttctctgttggtgtcttgccttatttggttgccaagggattgggccacga
tattacacctggtttgggtttgaaggagactttgccattgttgttttctgctgtcaaaga
aggaaaactcactacagaaagacaattattctccgcttgcataacaaatccaatcaagat
actccaccttcctaa

DBGET integrated database retrieval system