KEGG   Clavispora lusitaniae: CLUG_04974Help
Entry
CLUG_04974        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11484  
histone deacetylase HOS3 [EC:3.5.1.98]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     CLUG_04974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MSKYTQRDQAHDSDEDSLISQFETTLTIRSSNDVPGDEDLSIDHTTVIHGTTLSNLTRDE
SIVDIEELEEEEQLSEQIPNFKVKRESRLRTDKALRFKKESDSASSSRAQSPQIDPSLDQ
VLKPSPLVDVDLDRYHRTFEEFINANIQIKQESPRFRKETDKTLVLLSPYSAEHAFGRKW
VTKSYLSTIFERPQRLLASCIGISAALTMFPYFYSIKNSTKKGSLFSSHVRKVHGETWPK
KLFELCLKSHQKLQSDELEVPEDWNVGDIYLTPKTITALEGVVGTIETAVDSLYGSDNED
ENYNLTFVTIRPPGHHSHACLPSGFCLLNNAQIGIEYAFDKYGISHCAILDIDLHHGDGS
QDICWERAGFTGDYGKADEEYEDYEENPRNEYGKKFSTYPKVGYFSLHDIKSYPTESGFA
TKENIKNASLCVMDHDLNLWNVHLQEWSTEEEFYKHYQTKYVAILNRANQFLNSAKKQYE
SNYATYISELSKYNKFMAKPHLYKQAIKKPSPPVPFKPLIVISAGFDASEYENPQMQRHH
VNVPTSFYANFTKDVVKLAKIHTNGKVISFMEGGYSDGALISGVFSHLIGLTNNQKYDDN
DVSLWNQTWGNEYVVKELSKGCKRSWVPYKNPRTEVTIWANEAIKLGRSLMPNAILPTNY
VYQYVPEKSNIYAQPPEATNRMLRNLLDDNGSSKEFPNSPINKDPEDDRRLLRHTRSYYR
KTTK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagtacacgcagcgagatcaagcgcatgacagcgatgaggattcgttgatctct
caattcgaaacaaccttgacgatccgatcttcaaatgacgttcctggcgacgaagatttg
tccatcgatcatacaaccgtgatccacggcacaacgctctcgaatttgacgcgtgacgaa
tcaattgtggacattgaggaacttgaagaagaagaacagttgctggagcaaattcccaat
ttcaaggtgaaacgggagtccaggttgcgtacagacaaggcactaaggttcaaaaaggaa
tccgattcagcaagctcaagtagagcgcagtctccgcaaatagaccccagcttggatcaa
gtcttgaagccttcaccgttggtggatgttgatctagatcgctaccataggactttcgaa
gagttcatcaacgccaacattcaaataaaacaggagagcccccgtttcagaaaagagacg
gacaaaactcttgttttgttgtcgccgtactctgcagaacacgcatttggccgtaagtgg
gttacgaagtcctacctatcaactatttttgagcgaccacagcgcttgcttgcatcttgc
attggcatatcagcagcattgactatgtttccttatttttattcgataaagaactctacg
aagaaaggatctttgttttcaagtcatgttcggaaagttcatggagaaacatggcccaaa
aagttgtttgagctatgtttaaaatcccatcagaagctccaaagcgacgaacttgaagtt
cccgaagattggaatgtgggagatatctaccttactccaaagacaattacagccctagaa
ggagttgttggaaccattgaaacagcggtcgactcattgtatggttcggataatgaagac
gaaaattataaccttacttttgtcaccatcagacctccaggacatcattcgcatgcgtgc
ttacctagcggcttttgcttactaaataacgcgcaaatcggcatagagtatgcctttgac
aaatacggaatatcacattgtgctatcttggatattgaccttcatcatggagatggctct
caagatatttgttgggaaagagctggttttacgggtgattatggcaaggcagacgaagag
tatgaagattatgaagagaatcctaggaatgaatacggtaaaaagttctccacatacccc
aaagtgggctacttctcattgcatgacatcaagtcctatcctaccgagtctggctttgcg
accaaagagaatattaagaatgcttctctctgcgtaatggaccatgatttgaacttgtgg
aacgttcatttacaagagtggtcaacagaagaagaattttacaagcattatcaaacgaaa
tacgttgccattttgaaccgtgcaaaccagtttcttaacctggcaaaaaagcaatatgaa
ctgaattatgcaacatacatttctgagctttccaaatataataagtttatggcgaaacca
cacttatacaaacaggctataaaaaaaccgtcaccgccggttccattcaaacctttaatc
gtcatttcggctgggttcgatgcttccgaatatgaaaaccctcaaatgcagagacaccat
gtcaatgtacccacctccttttatgcaaatttcaccaaggatgtggtgaagcttgccaaa
atccacacaaatggcaaggtcatttccttcatggaaggtggctattcggatggggcgtta
atttcaggggttttttcccacttgattggtcttactaataaccagaaatatgacgacaat
gacgtttccttgtggaaccaaacctggggtaatgagtatgtcgtgaaagagttatctaag
ggatgtaaaagatcatgggtaccgtacaagaatcctcgaacagaagtgacaatatgggct
aatgaagcaattaaacttgggagatccttaatgcccaatgctattttacccacgaattat
gtgtatcagtacgttcctgaaaagctgaatatctacgcacaaccgccagaagccacgaac
cgaatgctccgaaacctcctagacgacaatggaagctctaaggaattcccgaatagcccc
atcaacaaagatccagaggacgacagaaggttattacggcatacaaggtcatactataga
aaaactaccaagtaa

DBGET integrated database retrieval system