KEGG   Clavispora lusitaniae: CLUG_05152Help
Entry
CLUG_05152        CDS       T01149                                 

Definition
similar to potential glutathione peroxidase/redox transducer
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
clu  Clavispora lusitaniae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:clu00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:clu00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 161 aa AA seqDB search
MSSFYELTPSDAKGNPYPFEQLKGKVVLIVNVASKCGFTPQYKELEELNKKYADKDVQIL
GFPCDQFGHQEPGTDEEIASFCSLNYGVTFPVLKKIEVNGDKADPVYKFLKSQKSGLLGL
NRIKWNFEKFLVDKKGNVVERYSSLTKPKSLEGKIDELLKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttctatgaactcactccatctgatgctaaggggaacccatacccctttgaa
caattgaagggcaaagttgtcctcattgtcaatgtcgcctccaagtgcggcttcacccca
cagtacaaggagttggaagagttgaacaaaaagtacgccgacaaggacgtgcagattctc
ggtttcccttgtgaccaatttggccaccaagagccaggcaccgatgaggaaattgcatcg
ttctgttctttgaactacggcgtcactttcccagtgttgaagaagattgaggttaatggc
gataaggctgaccctgtgtacaagtttttgaagagccaaaagtctggtcttttgggactc
aacagaatcaagtggaactttgagaagttcttggtggacaagaagggtaatgttgtggag
agatactcttctttgaccaagcccaagagtttggagggcaagattgacgagttgttgaag
gcctaa

DBGET integrated database retrieval system