KEGG   Clavispora lusitaniae: CLUG_05152Help
Entry
CLUG_05152        CDS       T01149                                 

Definition
similar to potential glutathione peroxidase/redox transducer
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
clu  Clavispora lusitaniae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CLUG_05152
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CLUG_05152
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CLUG_05152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 161 aa AA seqDB search
MSSFYELTPSDAKGNPYPFEQLKGKVVLIVNVASKCGFTPQYKELEELNKKYADKDVQIL
GFPCDQFGHQEPGTDEEIASFCSLNYGVTFPVLKKIEVNGDKADPVYKFLKSQKSGLLGL
NRIKWNFEKFLVDKKGNVVERYSSLTKPKSLEGKIDELLKA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctttctatgaactcactccatctgatgctaaggggaacccatacccctttgaa
caattgaagggcaaagttgtcctcattgtcaatgtcgcctccaagtgcggcttcacccca
cagtacaaggagttggaagagttgaacaaaaagtacgccgacaaggacgtgcagattctc
ggtttcccttgtgaccaatttggccaccaagagccaggcaccgatgaggaaattgcatcg
ttctgttctttgaactacggcgtcactttcccagtgttgaagaagattgaggttaatggc
gataaggctgaccctgtgtacaagtttttgaagagccaaaagtctggtcttttgggactc
aacagaatcaagtggaactttgagaagttcttggtggacaagaagggtaatgttgtggag
agatactcttctttgaccaagcccaagagtttggagggcaagattgacgagttgttgaag
gcctaa

DBGET integrated database retrieval system