KEGG   Clavispora lusitaniae: CLUG_05242Help
Entry
CLUG_05242        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
clu  Clavispora lusitaniae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CLUG_05242
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CLUG_05242
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 543 aa AA seqDB search
MDITPAHGSRHRSRSSSRTRNSTANSRSTSASRRPSLSGSRRSLSSASLNRLVITPTAID
LLQERTVPSINVVLDNSLPLDFFKQELIGLIKALRISKWHKRQLTVSNMSVTRISGALTN
SIYKIEYKDVSQQLSLPALLLRVYGKNVDSIIDRDSELQILIKLSAKKIGPKLLGIFENG
RFEQFLEGFITMGKDEIRNPVISQMLGRRMKDLHYKIDLDEQDRQLEFPVAWIQIMKWMR
LLETQILPSYDPKDVEDALLMPWAKFKEVVFSYREWLFAKYDTNKLYENYRFCHNDTQYG
NLLLRSSFEPMDVVQGEANNLSTSNKRDRDLAVIDFEYSGVNFAAYDIADHFSEWMSDYH
DADKPYFIHDDKYPSLKEQMNLLMSYIEYDFQFPTSNFITKNPVDANSDQKTIMEYEAKK
LYNEVIFWRATVQIFWSIWGLIQNGPNEKRSDVDDLSSRSEEQGVNSTYSITTGLDSVNI
SENAIEEEAITSTDDDFDYLKYTQQKAALIAGDFISFGLLSISDIDPKYHNVIKFLDTQV
LDV
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggacatcaccccagcccacggatccagacaccgttccagatccagctccagaacgaga
aactcgaccgcaaactcgagatcaacttcggccagccgaagaccctctttgagcggatct
cgccgctctttatcttctgcttccttaaaccgattggtgattacgccaaccgccattgac
ttgttgcaggagcggactgtgccgagcatcaatgttgttcttgataactctttgccgttg
gatttcttcaagcaggaacttattggactcatcaaggcgttgagaatcagcaaatggcac
aaacgccagttgacggtgagcaatatgctggtgactagaatctcgggcgctctcacgaat
tccatttataagattgagtataaggatgtatcgcagcaattgtcgcttcctgcgttgctt
ttgcgagtgtatggcaaaaacgtcgactcgattattgatcgagactcggagttgcagatt
ctcatcaagctttcggccaagaaaatcggtcctaagctcttggggatctttgagaacggc
cgctttgagcagttcttggaaggttttatcaccatgggtaaagatgaaatccgtaatcct
gtgatttcccaaatgttgggccgtagaatgaaagatctccactataaaatcgatttggat
gaacaggaccgccaattagagttccctgttgcatggatccaaatcatgaagtggatgcgt
ttattggagactcaaatcttgccttcctacgatccgaaagacgtggaagatgctttgtta
atgccatgggcaaagttcaaagaagtggtcttctcatacagagaatggctctttgccaaa
tacgacacgaacaagttgtatgagaactaccgcttttgccataatgatactcagtacgga
aatttgttattgagaagttcttttgaacccatggatgtggttcaaggagaagcaaataac
ctcagcacgagtaacaaaagggacagggacttggctgtgattgactttgaatactctggt
gtcaactttgctgcgtacgacattgcagaccatttctctgaatggatgtctgattaccac
gacgcagacaagccgtacttcattcatgatgacaaatatccgtcgttaaaggaacagatg
aacttgctcatgtcttacatcgagtacgactttcaattcccgacatcgaactttatcacc
aagaatcctgttgatgcgaacagtgatcaaaagactattatggagtacgaggccaaaaag
ctctacaatgaagtgattttctggcgagccacagtacagattttctggctgatttggggg
cttattcagaatgggcctaacgaaaagagaagtgatgttgacgatttgagctcgagatct
gaagaacaaggtgttaacagtacttatagcatcaccacaggcttggactcggtcaacatc
agcgagaatgcaattgaagaagaagcaatcacttcgacagatgatgatttcgattactta
aagtacacccagcaaaaggctgcgcttattgctggtgacttcatttcgtttggtcttctc
agcatttcagatatcgatccaaagtaccacaacgtcatcaagtttttggacactcaggtt
ttggatgtttaa

DBGET integrated database retrieval system