KEGG   Clavispora lusitaniae: CLUG_05283Help
Entry
CLUG_05283        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
clu  Clavispora lusitaniae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CLUG_05283
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CLUG_05283
Exosome [BR:clu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CLUG_05283
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 551 aa AA seqDB search
MSEKNQPFSVYNRAPSRWTSYVFNHFTLIGVLVLYILSSHLDVSFHQAPTKKQNVIFMVT
DGMGPASLSLARSFRQHRDNLPIGDILALDKFLVGSSRTRSSSSLVTDSAAGATAFSCGL
KSYNGAIGVDPNKNPCGTILEALKLQGWHTGLVVTTRITDATPAAFSSHVDYRFQEDLIA
EQQLGGYPLGRMVDLILGGGRCHFLPQSAGGCRADSRNLVEEAKEGNWSYVENRADFDAL
AGGENVSLPLLGLLAQTDIPYDIDRNASEYPSLAEQVKTALTALSKATEKSDHGFFLLIE
GSRIDHAGHHNDPAAQVREVLAYDEAFKEVLSFIDNSDVETVAISTSDHETGGLVTSRQV
SKSYPDYIWYPQVLLNSTHSGDYLASKIVSAKQSNIFKDDESFSDFIAKSIFEQDLGIYD
YTQREIYTVKKLANIQSELMYFLNNMVSIRSRTGWTTHGHSAVDVNIYAYSNSKRIDELL
YQRDPYTGLLGNHENIEIGSFMESVTHVDLKKVTELVRKTHHSPGAMAEAQVDSLHVAAL
GEQHSGCMQKS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaaaaaatcagcccttctctgtctacaacagagcgcccagccgctggacttcg
tacgtcttcaaccatttcaccttgattggtgtcttggtcttgtacattttgctgtcgcat
ttagacgtttcgttccaccaggctccgaccaagaaacagaatgtcattttcatggtcaca
gacggcatgggccctgcctcgttgtcgcttgcccgttccttcagacagcacagagataac
ttgcctatcggcgatattttggcgcttgacaaatttcttgtgggtctgtccagaacccgt
tccagtagcagtttggtgacagactcagctgctggcgccacggctttcagttgtggcctc
aaatcttacaatggtgccattggcgttgacccaaacaaaaacccctgcggcaccatcttg
gaagccttgaagttgcaaggttggcacactggcttagtggtgacgacacgaatcaccgac
gccactccagcagccttcagttcacacgtcgattaccgtttccaagaggaccttattgct
gaacaacagcttggcgggtaccccttgggccgcatggtggacttgattttgggtggaggc
agatgccactttttgcctcaatccgctggaggctgtcgtgcagactcaagaaacttggtg
gaagaggcaaaggagggcaactggtcgtatgttgagaacagagcagactttgacgctttg
gccggaggtgaaaacgtcagcttgcctcttttgggtcttttagcccagacagacatcccc
tacgacattgacagaaacgccagtgaatatccgtctttggccgaacaggtgaaaacagca
ttgaccgcattgagcaaggccaccgaaaaatctgaccacggtttctttttgcttattgaa
ggctccagaatcgaccacgcgggccatcacaatgacccagcggcgcaagtgagagaagtg
ttggcctatgacgaagctttcaaagaagttctttcattcatagacaactctgatgttgaa
actgttgccatctctacttctgaccacgagacgggaggattggttacctctagacaagtg
tcgaaatcgtatccggattacatttggtaccctcaagttttgttgaacagtactcactct
ggtgactatttggctagcaaaattgtatctgccaaacagtccaacatttttaaagatgat
gaaagcttttcggattttattgccaagtcgattttcgagcaagatcttggaatctacgac
tacacgcaaagagaaatttatacggttaagaaattggccaacatacaatccgagcttatg
tactttctcaacaatatggtttccatccgctccagaacgggctggactacgcacggccac
tcagcagttgatgtgaatatttacgcgtactccaattccaaaagaattgacgaactcctt
taccaaagggacccatatacgggattacttggaaatcacgagaatatagagattggctcg
ttcatggagtctgttacccatgtggatttgaagaaagttaccgaattggtacgaaaaact
caccattctcctggagcaatggccgaggctcaagtggacagcttacatgttgcagcattg
ggagaacagcactctggatgtatgcaaaagagttaa

DBGET integrated database retrieval system