KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05339Help
Entry
CLUG_05339        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu00230  Purine metabolism
clu01100  Metabolic pathways
Module
clu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLUG_05339
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CLUG_05339
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 RNA_helicase MMR_HSR1 AAA_24 AAA_28 ABC_tran AAA_30 NACHT AAA_14 RsgA_GTPase AAA AAA_29 NTPase_1 ATPase_2 DUF2075 AAA_5 T2SSE AAA_19 Rad17 MobB Cytidylate_kin cobW Adeno_IVa2 KAP_NTPase AAA_23
Motif
Other DBs
NCBI-GeneID: 8495195
NCBI-ProteinID: XP_002614560
UniProt: C4YB47
AA seq 185 aa AA seqDB search
MARPVVISGPSGTGKSTLLKKLFAEFPDKFGFSVSNTTRTPRAGEVDGVDYHFTKVEDFK
KMIDEKKFIEWAQFSGNYYGTSIKAVEDVVKSNKICLLDIDMQGVKSVKASTIDARYLFV
APPSIETLKERLTGRGTETEDSIAKRIAAATGEMEYAATGAHDLVIVNDDLDKAYEQFKN
FILAE
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggctagaccagttgttatttccgggccttcgggcactggtaagtccactcttttgaaa
aagctctttgctgagttccccgacaagtttggcttttctgtttccaacaccaccagaacc
cctagagccggcgaagttgatggtgtggactaccacttcaccaaggtggaggatttcaag
aagatgattgacgagaagaagttcatcgagtgggcccagttctcgggaaactactacggc
acgtccatcaaggccgttgaagacgtggtcaagtccaacaaaatctgtctcttggacatt
gatatgcaaggtgtcaagtcggtcaaggcttcgaccattgacgccagatacttgtttgtg
gcgcctccttcgatcgagactttgaaggagagattgactggaagaggcaccgagactgag
gattccattgccaagagaatcgccgctgccactggagagatggagtacgctgctactggc
gcccacgatttggtcattgtcaacgacgacttggacaaggcctacgagcaattcaagaac
tttattttggccgagtag

DBGET integrated database retrieval system