KEGG   Clavispora lusitaniae: CLUG_05455Help
Entry
CLUG_05455        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
clu  Clavispora lusitaniae
Brite
Enzymes [BR:clu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CLUG_05455
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_05455
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 567 aa AA seqDB search
MSHVHISQPHISVPRSSPQVQVSEAYGAPSSSRGVPYQSSPYPNYGSPSNGMSQLKGPER
VGPPSNRALQPNGTLQSNGTLQPNGTLQPNGTLHQYGASQGPYGVPYGAPHGNQQTGNYY
SGPQNYGTNQQYVTGSSHLQPHGHTNSHHYGHSSHGNGHHSHHSQTTHGNGHISKTQWMR
DNGVCGLKNLGSSCYINSTIQVLVGVDRFNSLFYRHANEWLTSRMRSSLAEAMVNLVATF
NINGGSNIAPTKFLKVLARLKPDFNIPNEQQDAQELLLFLLDRLHEDLATKPVSSDVDYI
ALWDIDVEPRDREEYLTWYRGLIKYQGESPVNDMCQGHVQSRLICNRCGHRSVSYSPFTI
LSLPIPHTNNNGVDLTDCLRYYTQDEVLSGENAWKCPKCDKSSDATKESPMDAVFQQKKG
MFRFSKRSKSPSKKTSTSPQPPATSITIKQLSFIKLPPVLFIHLSRFSFNLTDKVDTDIA
YPMRLQFNHHEHEITYNLRGFINHYGTLKSGHYTSLVKKNTGVGADGHSRSVWCSFDDDH
VGINVTHGDGHNKVHSRDVYVLCYERV
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatgtccatatactgcagcctcatatttctgtccctagaagcagtccacaagta
caagtaagtgaagcatacggagcacctctgtcgagcagaggagtaccatatcagctgtct
ccataccccaattatggcctgcccctgaacggtatgagccaattgaagggccccgagaga
gtgggtccaccctcgaatagagcattgcaacccaatggtacattgcaatcaaatgggaca
ttgcaacccaatgggacattgcaaccaaatgggacattgcatcaatatggcgcatcgcaa
ggaccgtatggagtaccatatggtgctcctcatgggaatcagcaaacgggaaattattac
agcggacctcaaaattatggaacaaatcagcaatatgtcacgggcctgtcacacttgcag
cctcatggccacacaaatagtcatcattatggtcattcttcacatggaaatggccatcac
agtcatcacagtcagactacacatggcaatggccatatttccaagacacagtggatgagg
gacaatggagtctgcggtctcaagaatttgggctcatcctgttatatcaacctgacgatt
caagtgttggtaggcgtggatcgtttcaatagtctcttttaccgtcatgctaacgagtgg
ctaacgtcacgaatgcgctcgctgttagcagaagcaatggtaaacttggtggcgacattc
aacattaacgggggttctaatatcgcgccaacgaagttcttgaaggtgttggcgcggctc
aaacccgacttcaacattcccaacgagcagcaagatgcacaggagttgttattgtttctc
ttggacaggctccatgaggatttggccacaaaacctgttctgtctgacgtggactatatt
gcgctttgggatatagacgtggagcccagagaccgagaagaatacttgacatggtaccgt
ggacttatcaagtatcaaggggaatcgccagtcaacgatatgtgccagggccacgtgcag
agcaggcttatctgtaatcgatgtggccaccgttcggtcagctacagtccattcacgatt
ttgtcacttcctattccgcacacaaacaacaacggagtcgatctcacggattgcttgcgt
tattatacccaggacgaggtccttagtggagaaaacgcttggaagtgtcccaagtgtgac
aaatcgctggatgccactaaggaaagcccaatggacgctgttttccagcagaagaagggt
atgttccgcttcagcaagcgcagcaagtcgccgtctaaaaagacatctacatcgccacag
ccgccggccaccagcattaccatcaagcagttgagtttcatcaaattgccgcctgttttg
tttattcatttatcccgtttttcgttcaacttgacagataaagttgacacggacattgca
tacccaatgcggctccagttcaaccaccatgaacatgaaattacgtacaatctccgtggg
ttcatcaaccactatggtacgctcaagagcggccactatacgagtctcgtgaagaaaaac
acgggagtcggcgcagatggtcattctcgctcggtatggtgctcttttgacgacgaccat
gtgggcatcaatgtgacgcacggcgatggccacaacaaggtccactcgagggacgtctat
gtgctttgctacgagcgtgtgtaa

DBGET integrated database retrieval system