KEGG   Clavispora lusitaniae: CLUG_05482Help
Entry
CLUG_05482        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
clu  Clavispora lusitaniae
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:clu03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 346 aa AA seqDB search
MAVLMHFGMTGMIHLRDVKSHLVFMENGGDKKIKSEKENGDETPELESEPEPQEWPPRFS
KFELELENGQKTELAFVDPRRLARVRLLWGPECSSDELLMQQEPLKRQGPDYSKGGEREV
KKEEGEVKREVKKEEGEVKEEVNKIKEEAEGEEGLAKAEQDVISLFSPSHEPSVSDFPRP
TVFHPDPDPDPHGRARLAFPDFAKLVLSRRKPIKALLLDQAFFAGVGNWVSDEILYHAQI
HPSENLAEHISDPEDPRLARLYYSLIYVMEVSVAVEGNVREFPENWLMLHRWGKRRKEKA
KTKMGYSVAFETVGGRTSCFVPELQKRMGPAVKRRKTSKEKQSDDE
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgttgatgcactttggcatgactggcatgatccaccttcgagatgtgaaatcg
catttggtgttcatggagaacggcggagacaagaaaatcaagctggaaaaggagaatggc
gatgaaacgcccgaattggagctggagccggagccgcaagagtggcctccgcggttttcg
aagttcgagctcgagttggagaatgggcagaaaacagaacttgcgtttgttgatcctagg
cggttggctcgggtccggcttttgtgggggcccgagtgttcgtcagacgagctcctaatg
cagcaggagccgttgaagcggcagggaccagactactcgaaaggaggagaaagagaagtg
aagaaagaagagggagaagtgaagagagaagtgaagaaagaggagggagaagtgaaggaa
gaggtgaacaaaatcaaagaagaggcagagggggaagaaggtctagccaaggctgaacag
gatgtgatttcgctcttttctccctctcatgagccttctgtgtccgatttccctcggcct
accgttttccatccagacccagatccagaccctcatggacgggctcggttagcgtttccc
gactttgccaagttggttttgtcgcgccgcaaacccatcaaggctcttcttctcgaccag
gcgttttttgccggcgtgggaaactgggtcagcgacgagattctttaccatgcccagatc
catccaagcgagaatttggccgagcacatttccgaccctgaagatccccgtcttgcaagg
ctctactacagcttgatctacgtgatggaggtaagtgtggcggtcgaggggaatgtgcgg
gaatttcccgagaactggctcatgctccatcggtggggaaaacggagaaaggaaaaggcg
aaaacaaaaatgggctattctgttgcgtttgaaactgtcgggggaagaacgagctgtttt
gtcccggagttgcagaagcgtatgggacctgctgtcaagagacggaaaacgtccaaggaa
aagcaaagcgatgatgaatag

DBGET integrated database retrieval system