KEGG   Clavispora lusitaniae: CLUG_05483Help
Entry
CLUG_05483        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00027  
malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
clu  Clavispora lusitaniae
Pathway
Pyruvate metabolism
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:clu01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:clu00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 655 aa AA seqDB search
MSVARHSGPAWPPRHPALPIYIATTPVLFSASMLLVRNRPQAKFGVRFTSGKSVHTHTIK
TPVGVKAAIASLKPKTTRLSIEGPIECDLTGFQLLNSPIFNKGSAFTQEERRAFGLSGLL
PCKVNTLQEQVERAYAQFQYLKTPLAKNDFLTSMRIQNKVLYYELVRNHIREMLPIIYTP
TEGDAIAAYSHRFRKPEGCFLDITDPDSIDERLSAYGEDKDIDYIVLSDGEGILGIGDQG
VGGIRIAIAKLGLMTLCAGIHPGRVLPVVLDVGTNNVDLQNDDLYMGNKFERVRGQQYWD
FVDRFIQTVKKRFPSAVLHYEDFGVTTGRTMLHRYRSELPSFNDDIQGTGAVVMASITAA
LKFSNRDLLDTRVLIYGAGSAGLGVADQIVNHMVSHGSTVEDACKQITIMDRRGVVLQSY
KDSSEGQLRYADPDSKWDGINTKSLVDVVSKVKPTVLVGCSTQAGAFTEQVIKEMYKHNP
QPIVFPLSNPTRLHEAFPVDIMRWTDNRALIATGSPFQPVDGYYISENNNCFTFPGIGLG
AVLSRCTTITDTMISAAVDQLASMSPKMDNPKNGLLPPLEQIDEVSAYVATAVILQSLKE
GTARVESEEKPDGGFVEVPRDFKQCLKWVQSQMWRPVYRPLVKVSHEPEIHTFQY
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttgcgcgacattccggtccggcctggcccccacgacatccggccctccccata
tatatagccaccactcccgttcttttctccgccagtatgttgcttgtcagaaatcggccc
caggccaagtttggcgtgcgtttcacgtcgggaaaatccgtccacacccacaccatcaaa
acacctgttggcgtcaaggcggccattgcttcgctcaaaccgaaaaccacccgtttgtcg
atcgaaggccccatcgaatgtgacttgacgggcttccagttgctcaactcgcccattttc
aacaagggctcggcgttcacgcaagaagagcgccgtgcgtttgggcttctggggcttctt
ccttgcaaagtcaacacgttgcaggaacaggtggaaagggcgtacgcccagttccagtac
ttgaagacgccgctcgccaagaacgatttcctcacgtccatgcggatccagaacaaggtc
ttgtactacgagttggtgcgcaaccacatccgcgagatgttgcccatcatctatactcca
accgagggagacgccattgccgcctactcgcaccggttccgcaagcccgagggctgtttc
ttggacattacggacccggactccatcgacgagcgcttgtcggcctatggcgaggacaag
gacatcgactacattgtgttgagtgacggagagggcattttgggcattggagaccagggc
gtgggcggcatccgtattgccatcgccaagttgggtctcatgacgctctgtgccggtatc
cacccgggccgtgttttgcctgtggtgttggacgtcggcaccaacaacgtcgacctccag
aacgacgacttgtacatgggcaacaagtttgagcgtgtgcgcggacaacagtactgggac
tttgtggaccgcttcatccagacggtcaagaagcggttcccgctggccgtgttgcactac
gaggactttggcgtcaccaccggccgcaccatgttgcatcgctacagatcggagttgccc
tcgttcaacgacgacatccagggcactggcgctgttgtcatggcgtccatcacggccgcg
ctcaagttctccaaccgtgacttgctcgacacgcgtgttttgatctacggcgccggttcg
gccggcttgggtgtggcggaccagatcgtcaaccacatggtgtcgcacggcctgaccgtg
gaggacgcctgcaagcagatcaccatcatggaccgccgcggtgtggtgctccagctgtac
aaggactcgagcgagggccagttgcggtacgcggacccagactcgaagtgggacggcatc
aacaccaagagcttggtggacgtggtgtccaaggtcaagcccacggtgcttgtgggctgc
ctgacacaggcgggcgccttcaccgagcaggtgatcaaggagatgtacaagcacaaccca
cagccgattgttttccctctttcgaacccaacacgcttgcacgaggcgttcccagtggac
atcatgcggtggaccgacaaccgtgcgttgatcgccacgggctcgcccttccagcccgtc
gacggctactacatctcggaaaacaacaactgcttcacgttccccggcattggtttgggc
gccgttctctcgcggtgcaccaccatcaccgacacgatgatctcggcggccgtggaccag
ttggcgctgatgtcgcccaagatggacaaccccaagaacggcttgcttccgcccttggag
cagattgacgaggtttcggcatacgtggccactgcggtcattttgcagagtttgaaggaa
ggcactgctcgtgttgagagcgaggaaaagcccgacggcggctttgtggaggtgcctcgt
gacttcaagcagtgcttgaagtgggtccagtcgcaaatgtggcgtcctgtttaccgtccg
ttggtgaaggtgagccacgagccggagatccacactttccagtactag

DBGET integrated database retrieval system