KEGG   Clavispora lusitaniae: CLUG_05509Help
Entry
CLUG_05509        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
clu  Clavispora lusitaniae
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CLUG_05509
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CLUG_05509
Enzymes [BR:clu01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CLUG_05509
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSQLLDTSYGKANVKFLKVRKDAANPAVQDVLEANCQVLLRGNFDVSYTEADNSPVVPTD
TVKNTILVEAKKTNVWPIERFAAHLAKHFTGKYSHVSGVEITIVQSRWTKYEVNGSLHAH
SFRNEGPETRRTFLVYSKASGQLSITSSIKDLTVLKSTGSMFYGYHQCDYTTLKPTKDRI
LSTDVDASWKYSASALKSLDNVITLADKGVFDQTYDTARKVTLDLFALENSPSVQATMYN
MASLILSKAPAVESVTYVLPNKHYILYNLEWKGIKDNTELFYPSPDPNGLIKCTVGRKTA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttattagatacttcctacggcaaagccaacgtcaagtttttgaaagtcaga
aaagacgccgcaaacccagctgtccaagatgttttggaggccaactgccaagttttgttg
agaggcaactttgacgtttcctacaccgaagccgacaactcccctgtcgtgcctacagac
actgtcaaaaacaccattttggtggaggccaagaagacaaacgtgtggccaatcgaaaga
tttgcagcccacttggccaaacacttcacggggaagtactcccacgtgtctggtgtcgaa
atcaccattgtccaatcgcgctggacaaagtatgaggtcaacggaagcttgcacgcccac
tctttccgcaatgagggcccagaaacccgcagaacgttcttggtctactcaaaagcatct
ggccaattgagcatcacttcctccatcaaggatttgaccgtcttgaagtccacaggctcc
atgttctatggctaccaccaatgtgactacaccactttgaagcccaccaaggaccggatc
ttgtcgaccgacgtggatgcgctgtggaaatacagtgcctcggctttgaagtcgcttgac
aacgtcatcactcttgccgacaagggcgttttcgaccagacttacgacaccgctcgtaaa
gtcactttggacttgtttgcattggaaaactctccctccgtgcaagctaccatgtacaac
atggcgtctttgattttgtcaaaggcccctgctgtggagctggtgacatacgttttgcct
aacaagcactacatcttgtacaacttggagtggaagggcatcaaggacaataccgagttg
ttctatccttcgcctgatccaaatggcttgatcaagtgcacagtgggcagaaagactgcc
aagttgtag

DBGET integrated database retrieval system