KEGG   Clavispora lusitaniae: CLUG_05509Help
Entry
CLUG_05509        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
clu  Clavispora lusitaniae
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:clu00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 302 aa AA seqDB search
MSQLLDTSYGKANVKFLKVRKDAANPAVQDVLEANCQVLLRGNFDVSYTEADNSPVVPTD
TVKNTILVEAKKTNVWPIERFAAHLAKHFTGKYSHVSGVEITIVQSRWTKYEVNGSLHAH
SFRNEGPETRRTFLVYSKASGQLSITSSIKDLTVLKSTGSMFYGYHQCDYTTLKPTKDRI
LSTDVDASWKYSASALKSLDNVITLADKGVFDQTYDTARKVTLDLFALENSPSVQATMYN
MASLILSKAPAVESVTYVLPNKHYILYNLEWKGIKDNTELFYPSPDPNGLIKCTVGRKTA
KL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagttattagatacttcctacggcaaagccaacgtcaagtttttgaaagtcaga
aaagacgccgcaaacccagctgtccaagatgttttggaggccaactgccaagttttgttg
agaggcaactttgacgtttcctacaccgaagccgacaactcccctgtcgtgcctacagac
actgtcaaaaacaccattttggtggaggccaagaagacaaacgtgtggccaatcgaaaga
tttgcagcccacttggccaaacacttcacggggaagtactcccacgtgtctggtgtcgaa
atcaccattgtccaatcgcgctggacaaagtatgaggtcaacggaagcttgcacgcccac
tctttccgcaatgagggcccagaaacccgcagaacgttcttggtctactcaaaagcatct
ggccaattgagcatcacttcctccatcaaggatttgaccgtcttgaagtccacaggctcc
atgttctatggctaccaccaatgtgactacaccactttgaagcccaccaaggaccggatc
ttgtcgaccgacgtggatgcgctgtggaaatacagtgcctcggctttgaagtcgcttgac
aacgtcatcactcttgccgacaagggcgttttcgaccagacttacgacaccgctcgtaaa
gtcactttggacttgtttgcattggaaaactctccctccgtgcaagctaccatgtacaac
atggcgtctttgattttgtcaaaggcccctgctgtggagctggtgacatacgttttgcct
aacaagcactacatcttgtacaacttggagtggaagggcatcaaggacaataccgagttg
ttctatccttcgcctgatccaaatggcttgatcaagtgcacagtgggcagaaagactgcc
aagttgtag

DBGET integrated database retrieval system