KEGG   Clavispora lusitaniae: CLUG_05551Help
Entry
CLUG_05551        CDS       T01149                                 

Definition
hypothetical protein
Organism
clu  Clavispora lusitaniae
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MFKAPNTSQTSLASTKEKELPPIPSETRHGEDPPLLAPKSLNRKNVKHLSFTPPSPAPPA
DYSGEFSRFERLDSSQKKNRLRPAPLLNLHSPSKAPQPTIIDSLQGLELAEPAVGAASTQ
RKRQTVISSISPTRSVYTPSPREASSPGFTSASSHTSPLPTTPVSTVSSSHSIRDEDLVH
LKDLGAGNFGVVSKVVHVPSSKTMAKKIVHVDSKPEVQTQIIRELRIMHECRSPYIIEFY
GAFARSNNAIVICMEYCNCGSLDKIVQLCDPPQFPLFVLRKLSYAILSGLNYLYHTHRII
HRDIKPSNVLMTHRGDFKLCDFGVSRELTNSLAMADTFVGTSTYMSPERIQGLTYGVRSD
VWSMGLMLYELASGQRVWYEDDVDDGGSRPAGPEGILDLLQRIVNEKSPTLTGKSNRYTH
EPYNADLCDFVDHCLVKNDQQRSSPQELLQEPLLDGVAQGVYDKEVRAWAKVIRKRHKEH
NGHD
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaagcgcccaatacttcccagacatcactagcgtctaccaaggagaaagagctc
ccgccgattccgtcggaaacgcggcatggcgaggatccgccgttgcttgcgcccaagtcg
ctcaaccgcaagaacgtcaagcacctctccttcacgccgccgctgcctgctccgccggca
gactactcgggcgagttttcccgctttgagcggctcgacctgctgcaaaagaagaaccgc
ctccgcccggcgcccttgctcaacttgcacctgccgtccaaggcgccgcagcccaccatc
atagacagtctccaagggttggagttggcggagcctgctgtcggagcggcgtcgacgcag
cggaaacgccaaacggtcatcagctccatctcgcccacgcgctccgtgtacacgccgctg
ccccgtgaggcgtctctgcccggcttcacgtcggcgtcttcgcatacatctccgttgccc
accacgcccgtttcgaccgtgtcttcgtcgcacagcattcgcgacgaggaccttgtgcat
ctcaaggacttgggcgccggcaacttcggcgtggtgctgaaggtggtgcatgtgccgctg
ctgaaaaccatggccaagaaaatcgtccatgtggacctgaagcccgaagtgcaaacgcaa
atcatccgcgagctccgcatcatgcacgagtgccggtcgccgtacatcattgagttctac
ggggcgtttgcgcggtccaacaatgccatcgtcatctgcatggagtattgcaactgcggt
ctgctcgacaagattgtacagttgtgcgatccgccgcagttcccgcttttcgtgctccgc
aaattgctgtatgcgattcttctggggctcaactatctctaccacacccaccgcatcatc
caccgcgacatcaaaccttccaacgtgttgatgacgcatcgcggcgactttaagctctgc
gactttggtgtttctcgtgagctcaccaattctcttgctatggccgacacttttgttggc
acgtcgacttacatgtctccagaacgtattcagggtcttacgtacggagttaggtccgac
gtatggtcgatggggcttatgctttacgagttggcctcgggccaaagagtatggtatgaa
gatgacgttgacgatggcggttctcgacccgcagggcccgaaggcatcttggatctccta
cagcgtattgtcaacgaaaagtcgcccactcttacgggaaaatcaaaccgctatacgcat
gagccgtacaatgcggacttgtgtgattttgtggaccattgtttggtcaaaaacgaccag
cagcgcctgtcaccccaggaactcttgcaagaacctttgttggacggcgtggctcagggc
gtatacgataaggaagttcgggcatgggcaaaagtcattcggaagcgacacaaggagcac
aatggacacgactag

DBGET integrated database retrieval system