KEGG   Clavispora lusitaniae: CLUG_05670Help
Entry
CLUG_05670        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
clu  Clavispora lusitaniae
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:clu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 831 aa AA seqDB search
MPLFATQNDPPLGPAMTITPSISELESTSKSVFEHIVPSMTKGSTLVDHVITLLENFKFQ
ADKHKKLGYCDYGVAFVSFRVSQMLLDSASELNSPKIESFLIQIREALENQRGNFNIMCA
CIHQEAKSVADDPLLQRFSKLKGNINGMDVSQYKKSDSISPQCLNQLIRKIPQSILLLDF
RSKKEYSYSHINFSNVVNIEPSLVKSLLEKQPNAKDSDLEDCLRSKLEPEKFAMFSNRHK
YDIVVIYNLRFGGAASDRFISLEQSLLNGDKDGLAYANPFLKLIDLLMFRTKYLSSVLRQ
YPLYLSGGLHKWYQTFGEGSLTNVVSNDSTLNKLSQKPSDGTQAMKNSIYLRNFSDYLIS
AHSHSTDYSALIPESEGVKANSDSVIPASKMEPASHKGVDSSPMKLISRPKTVQEVSRKV
EKNNVPAGRPQTENSSDDFLKSFATGLTNLGNSCYMNCIIQCLAATPQMTDFFFKKGDKS
AEPSYKQHINMNNKLGTKGVITTSYVKLLSNMLNNSGGSFSPNVFKKIMGSLSPGAQFAN
SDQQDCVEFLNYILDSLHEDLNQRAVKNAEERASIMELSTEQERAREVLPIRLASTIEWE
RYLKLNFSVIVDYFQGQYLSQLKCLVCQLTSTTYNTFSVLSLPIPESDARYPRSVSLSQC
LDLFTETELLDDDNKWHCPRCNTFTRSTKKISITRLPKALIIHFKRFGYESSGRFKKLDT
FIKYPVNDELDLTSYWPEVGSYTKEDSSARISVEKERELLATMPVRNQSPPFKYKLYGVV
NHFGNLTTGHYTSYVKKEKGWCYFDDAKVTVGCDESSVLTKSAYCLFYQRV
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgccactattcgccacgcagaatgatcctccattaggcccagcaatgactattacacct
tcaatctcggagctcgaatcaacctccaagtcggtttttgaacacatagtcccatccatg
acgaaaggcagcacattagttgatcatgttatcacattgcttgagaatttcaaattccag
gccgataagcacaagaagctaggctattgcgattatggagtggcatttgtttcctttcga
gttagtcaaatgcttcttgattctgcaagtgagctcaatctgccaaaaattgaaagcttc
ttgattcagattcgagaggcccttgaaaatcaacgaggtaacttcaacattatgtgtgca
tgcattcatcaggaagctaagtctgtggctgatgacccattattgcaacgattctcaaag
ttaaagggtaatatcaacggaatggatgtttctcagtacaaaaaaagtgacagtatttct
cctcaatgtttgaatcaattgatcagaaagataccccaaagtattttgctccttgacttc
agaagcaagaaagaatattcttacagtcatatcaacttcctgaatgttgtgaatattgaa
ccatccttggtaaagctgttgttagaaaaacaaccaaacgcgaaagactcagacctcgaa
gattgtttgagaagcaaattagaacctgagaagttcgccatgtttagcaacagacataag
tatgatattgttgtcatctataatttgaggttcggtggtgcagctagtgatcgatttatt
tcattggagcaactgctattaaatggtgacaaggatgggcttgcgtatgccaatccattc
cttaagctaatagacttgctcatgttccgcacgaagtatttgagttcagttttgcgtcag
tatcctctttatcttagtggtgggttgcataaatggtatcagactttcggggaaggcagc
ttaactaatgtggtctccaatgactctaccttgaacaaattgtcccagaaacctctggat
ggcacgcaggctatgaaaaacagtatttatcttcgaaatttcagtgactatttgattagt
gctcattcacattccacggattatagcgcgcttatcccagaatccgaaggtgttaaggcg
aattcggattcagtcattccagcttccaaaatggaacctgcttctcataagggagtggat
agttcccctatgaaacttatctctcggcctaagacagttcaggaggtctctcggaaagtg
gagaagaacaatgtaccagcgggaagacctcaaacagaaaattcttcagatgatttcttg
aaactgtttgcaacgggtctcacaaatctagggaattcctgttacatgaactgtatcatc
cagtgtcttgctgctacacctcaaatgacagattttttcttcaagaaaggagacaaatct
gcggaaccctcctacaaacaacacataaacatgaacaacaagcttggcaccaaaggtgtc
ataactacaagctatgtgaagcttctttcaaatatgttgaacaacagcggtgggtcattt
tcacccaatgttttcaagaagattatgggctctttgtctccgggagcgcaatttgcaaat
tccgaccagcaagactgtgttgagtttttgaattacattttagattctttgcatgaggat
ttgaaccagcgggcagtgaagaatgctgaggagcgggcttctattatggaactctcaaca
gaacaagaacgtgccagagaagtgcttccaattaggttggcttctactattgagtgggaa
cgctatcttaaacttaatttctctgtcattgttgactatttccagggacagtatttgtca
cagttgaaatgtttggtatgtcaacttacatctacgacttacaacacgttttctgtctta
tccttacccataccagagagcgatgcaagatatcctcggtctgtactgttgtctcagtgt
ttggatttgtttactgaaaccgagcttttggacgacgataataaatggcactgtcctcgc
tgcaatacgtttacgaggctgacgaagaaaatttctatcacaagattaccaaaggcactt
ataatacattttaaaagatttgggtacgaatcaagtggcagatttaagaaacttgacacg
ttcataaaatatccagtgaatgatgagttggacctaacctcatactggccagaagttggc
agctacaccaaggaagattcatcagctagaatcagtgttgagaaagaacgcgagctacta
gcaacaatgccagttcggaaccagagtcctcctttcaagtacaagttgtatggtgttgta
aatcattttggaaacttgaccacggggcattacacttcttatgtcaaaaaagagaaaggc
tggtgctatttcgatgatgctaaagtgactgttggttgtgatgaatcctctgttttgacc
aaatcggcgtattgcttattctatcagagggtttag

DBGET integrated database retrieval system