KEGG   Clavispora lusitaniae ATCC 42720: CLUG_05670Help
Entry
CLUG_05670        CDS       T01149                                 

Definition
(RefSeq) hypothetical protein
  KO
K11839  ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
clu  Clavispora lusitaniae ATCC 42720
Pathway
clu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:clu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CLUG_05670
Enzymes [BR:clu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CLUG_05670
Peptidases [BR:clu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CLUG_05670
Membrane trafficking [BR:clu04131]
 Endosome - Lysosome transport
  Others
   Others
    CLUG_05670
Ubiquitin system [BR:clu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    CLUG_05670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 Rhodanese zf-MIZ
Motif
Other DBs
NCBI-GeneID: 8494921
NCBI-ProteinID: XP_002614184
UniProt: C4YBU2
AA seq 831 aa AA seqDB search
MPLFATQNDPPLGPAMTITPSISELESTSKSVFEHIVPSMTKGSTLVDHVITLLENFKFQ
ADKHKKLGYCDYGVAFVSFRVSQMLLDSASELNSPKIESFLIQIREALENQRGNFNIMCA
CIHQEAKSVADDPLLQRFSKLKGNINGMDVSQYKKSDSISPQCLNQLIRKIPQSILLLDF
RSKKEYSYSHINFSNVVNIEPSLVKSLLEKQPNAKDSDLEDCLRSKLEPEKFAMFSNRHK
YDIVVIYNLRFGGAASDRFISLEQSLLNGDKDGLAYANPFLKLIDLLMFRTKYLSSVLRQ
YPLYLSGGLHKWYQTFGEGSLTNVVSNDSTLNKLSQKPSDGTQAMKNSIYLRNFSDYLIS
AHSHSTDYSALIPESEGVKANSDSVIPASKMEPASHKGVDSSPMKLISRPKTVQEVSRKV
EKNNVPAGRPQTENSSDDFLKSFATGLTNLGNSCYMNCIIQCLAATPQMTDFFFKKGDKS
AEPSYKQHINMNNKLGTKGVITTSYVKLLSNMLNNSGGSFSPNVFKKIMGSLSPGAQFAN
SDQQDCVEFLNYILDSLHEDLNQRAVKNAEERASIMELSTEQERAREVLPIRLASTIEWE
RYLKLNFSVIVDYFQGQYLSQLKCLVCQLTSTTYNTFSVLSLPIPESDARYPRSVSLSQC
LDLFTETELLDDDNKWHCPRCNTFTRSTKKISITRLPKALIIHFKRFGYESSGRFKKLDT
FIKYPVNDELDLTSYWPEVGSYTKEDSSARISVEKERELLATMPVRNQSPPFKYKLYGVV
NHFGNLTTGHYTSYVKKEKGWCYFDDAKVTVGCDESSVLTKSAYCLFYQRV
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgccactattcgccacgcagaatgatcctccattaggcccagcaatgactattacacct
tcaatctcggagctcgaatcaacctccaagtcggtttttgaacacatagtcccatccatg
acgaaaggcagcacattagttgatcatgttatcacattgcttgagaatttcaaattccag
gccgataagcacaagaagctaggctattgcgattatggagtggcatttgtttcctttcga
gttagtcaaatgcttcttgattctgcaagtgagctcaatctgccaaaaattgaaagcttc
ttgattcagattcgagaggcccttgaaaatcaacgaggtaacttcaacattatgtgtgca
tgcattcatcaggaagctaagtctgtggctgatgacccattattgcaacgattctcaaag
ttaaagggtaatatcaacggaatggatgtttctcagtacaaaaaaagtgacagtatttct
cctcaatgtttgaatcaattgatcagaaagataccccaaagtattttgctccttgacttc
agaagcaagaaagaatattcttacagtcatatcaacttcctgaatgttgtgaatattgaa
ccatccttggtaaagctgttgttagaaaaacaaccaaacgcgaaagactcagacctcgaa
gattgtttgagaagcaaattagaacctgagaagttcgccatgtttagcaacagacataag
tatgatattgttgtcatctataatttgaggttcggtggtgcagctagtgatcgatttatt
tcattggagcaactgctattaaatggtgacaaggatgggcttgcgtatgccaatccattc
cttaagctaatagacttgctcatgttccgcacgaagtatttgagttcagttttgcgtcag
tatcctctttatcttagtggtgggttgcataaatggtatcagactttcggggaaggcagc
ttaactaatgtggtctccaatgactctaccttgaacaaattgtcccagaaacctctggat
ggcacgcaggctatgaaaaacagtatttatcttcgaaatttcagtgactatttgattagt
gctcattcacattccacggattatagcgcgcttatcccagaatccgaaggtgttaaggcg
aattcggattcagtcattccagcttccaaaatggaacctgcttctcataagggagtggat
agttcccctatgaaacttatctctcggcctaagacagttcaggaggtctctcggaaagtg
gagaagaacaatgtaccagcgggaagacctcaaacagaaaattcttcagatgatttcttg
aaactgtttgcaacgggtctcacaaatctagggaattcctgttacatgaactgtatcatc
cagtgtcttgctgctacacctcaaatgacagattttttcttcaagaaaggagacaaatct
gcggaaccctcctacaaacaacacataaacatgaacaacaagcttggcaccaaaggtgtc
ataactacaagctatgtgaagcttctttcaaatatgttgaacaacagcggtgggtcattt
tcacccaatgttttcaagaagattatgggctctttgtctccgggagcgcaatttgcaaat
tccgaccagcaagactgtgttgagtttttgaattacattttagattctttgcatgaggat
ttgaaccagcgggcagtgaagaatgctgaggagcgggcttctattatggaactctcaaca
gaacaagaacgtgccagagaagtgcttccaattaggttggcttctactattgagtgggaa
cgctatcttaaacttaatttctctgtcattgttgactatttccagggacagtatttgtca
cagttgaaatgtttggtatgtcaacttacatctacgacttacaacacgttttctgtctta
tccttacccataccagagagcgatgcaagatatcctcggtctgtactgttgtctcagtgt
ttggatttgtttactgaaaccgagcttttggacgacgataataaatggcactgtcctcgc
tgcaatacgtttacgaggctgacgaagaaaatttctatcacaagattaccaaaggcactt
ataatacattttaaaagatttgggtacgaatcaagtggcagatttaagaaacttgacacg
ttcataaaatatccagtgaatgatgagttggacctaacctcatactggccagaagttggc
agctacaccaaggaagattcatcagctagaatcagtgttgagaaagaacgcgagctacta
gcaacaatgccagttcggaaccagagtcctcctttcaagtacaagttgtatggtgttgta
aatcattttggaaacttgaccacggggcattacacttcttatgtcaaaaaagagaaaggc
tggtgctatttcgatgatgctaaagtgactgttggttgtgatgaatcctctgttttgacc
aaatcggcgtattgcttattctatcagagggtttag

DBGET integrated database retrieval system