KEGG   Clavispora lusitaniae: CLUG_05816Help
Entry
CLUG_05816        CDS       T01149                                 

Definition
cAMP-dependent protein kinase type 2
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
clu  Clavispora lusitaniae
Pathway
Meiosis - yeast
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:clu00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CLUG_05816
Enzymes [BR:clu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CLUG_05816
Protein kinases [BR:clu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CLUG_05816
Messenger RNA biogenesis [BR:clu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     CLUG_05816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 441 aa AA seqDB search
MPTSSILRKLHLTRPNHTSEITINSLDNVHSMEYQPAVQNQGQATQLGQTGVPQAHMGQP
QVAHGQLNPGQMGQPQLSQGQSQLSSGQSQLSSGQANAGQVLQHRQQEAVQSSLLPQKST
VSKGKYSLADFTIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDER
RMLKLVEHPFLIRMWGTFQDQKNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVL
ALEYLHSHDIIYRDLKPENILLDRSGHIKITDFGFAKEVNTVTWTLCGTPDYIAPEVITS
KPYNKSVDWWSLGVLIYEMLAGYTPFYDSTPMKIYEKILSGKIHFPSLMHPDVVDLLSRL
ITADLSSRLGNLLNGPADIRNHPWFSEVVWEKLLAKDIETPYEPPIAAGVGDSSLFDHYP
EEQSDYGSVGEDPYAEYFTEF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgccgacctccagcatcctcagaaagctccaccttactagaccgaaccacacttcggaa
atcacaatcaactctttggataacgtccattcgatggagtaccagccggccgttcagaac
cagggccaagccacccaattgggccagactggcgtgccccaagcccacatgggccagcca
caggtggcgcatggccaattgaacccaggccagatgggtcagccgcaattgagccagggc
cagctgcaattgagcctgggccagctgcaattgagtctgggccaagcaaacgcaggccag
gttttgcagcaccgccaacaggaggcggtgcaatccagcctcttgccacaaaagtccacc
gtctccaaaggcaagtacctgcttgcagacttcaccatcatgcgcacgttgggcacaggg
tcgtttggccgtgtccacttggttcgctccgttcacaacggacgctactacgccattaag
gttttgaagaaacagcaggtggtgaagatgaaacaagtggaacacaccaacgacgagcgg
cgcatgttgaagttggtggagcaccccttcttgatcagaatgtggggcacgttccaggac
cagaaaaacttgtttatggtgatggactacattgaaggtggcgagttgttctcgttgttg
agaaagtcccagcgctttcccaacccagtggccaagttctacgcggctgaagtggttttg
gccttggaatacctccactcgcacgatatcatctaccgagacttgaaacccgaaaacatt
ttgttggaccgcagtggccacatcaaaatcacagattttggtttcgccaaagaagtcaac
accgtgacttggaccttgtgtggtacgccagactacattgccccagaagttatcacttcc
aagccttacaataagtctgtcgactggtggtctttgggtgttttgatttacgaaatgctt
gccggatacaccccattctacgactcgactcccatgaaaatctacgagaagatcttgtcg
ggcaaaatccacttcccgagcttgatgcaccctgacgtggtggatttattgtcgcgctta
atcactgcagacttgtcttctcgtttgggaaacttgttgaacggtccggccgatatccgt
aaccacccttggttttctgaggtggtgtgggagaaattgttggccaaggacattgaaact
ccgtacgagccaccaattgctgcaggcgtcggcgattcctctttgttcgaccattaccca
gaagagcagctggactacggctctgtgggcgaagatccttatgcggagtacttcacggag
ttctga

DBGET integrated database retrieval system