KEGG   Clavispora lusitaniae: CLUG_05823Help
Entry
CLUG_05823        CDS       T01149                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
clu  Clavispora lusitaniae
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:clu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CLUG_05823
   03420 Nucleotide excision repair
    CLUG_05823
   03430 Mismatch repair
    CLUG_05823
   03440 Homologous recombination
    CLUG_05823
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 294 aa AA seqDB search
MQIRHRTRTNPKLHAWWAMGWYHVTMPIIATRSYSSFLSLLFKMDTSYGNYGDGGFSTDA
QFNEYNTSQRAQQTRSTLSPVTIKQINDATQPVSDGEFVVNNVSLNMVSFVGVVRKVENT
TSAHTITIEDGTGSVDVRRWVDEKVTTAAQETERFSALENKYVYVTGALKEFNQKKNVQH
ATIREITDHNEVLYHMLYAISNHLEAQGLMKTEPKAENGLFVQGTSAAGSGLDVLDKIMA
LIAANTPSMPEGVPTTWISDNLGLSVDEVKEKCHQLSEMAKIYQGYDEASYLSI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcaccgaactagaacaaacccgaaattacatgcctggtgggccatgggt
tggtatcacgtgaccatgcccattatcgcgacgcgttcctactcgtcttttctttctctt
ctctttaagatggatacgagttatggaaactacggcgacggtggattttccacagacgct
caatttaacgaatacaacacgtcccagcgtgcccagcaaactagatcaactttaagtccc
gtgaccatcaagcaaatcaacgacgcgactcagccagtttccgatggcgagtttgtggtt
aataacgtgtctttgaacatggtttcgtttgtcggggttgtccgcaaggtggaaaacacc
accagtgcccatactatcaccattgaagacggaacagggtctgtggatgttaggagatgg
gtggacgagaaagtcaccaccgcggctcaggaaaccgagcggttcctggcattggagaac
aaatacgtgtacgtgacgggcgcattgaaggaattcaaccagaagaagaacgtccagcat
gccaccatccgtgagatcaccgaccacaacgaggtgttgtaccacatgctatatgctatt
tccaaccacttggaggcgcagggcttgatgaagactgaacccaaggctgaaaacggcttg
tttgtgcagggcacgctggccgctggtctgggcttggatgttttggataagatcatggct
cttattgcagcaaacacgccttccatgccagaaggcgttccaacgacgtggattagtgat
aacttgggtctctctgtggatgaggtcaaggagaagtgccaccaattgtctgagatggca
aaaatctaccagggctacgatgaggcgtcgtacttgagtatttaa

DBGET integrated database retrieval system