KEGG   Columba livia (rock pigeon): 102083878Help
Entry
102083878         CDS       T02912                                 

Gene name
KAT2A
Definition
(RefSeq) K(lysine) acetyltransferase 2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102083878 (KAT2A)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102083878 (KAT2A)
Transcription machinery [BR:clv03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102083878 (KAT2A)
Chromosome [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102083878 (KAT2A)
   HAT complexes
    PCAF complex
     102083878 (KAT2A)
    STAGA complex
     102083878 (KAT2A)
    TFTC complex
     102083878 (KAT2A)
    SAGA complex
     102083878 (KAT2A)
    SLIK complex
     102083878 (KAT2A)
    ADA-HAT complex
     102083878 (KAT2A)
    HAT-A2 complex
     102083878 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 746 aa AA seqDB search
MVLEHSRGRKAQVRGFPRGKKLEKLGVFSACKANDACKCNGWKNPNPPTAPRMDLXLSEP
CRSCGHALADHVSHLENVSEEEINRLLGMVVDVENLFMSVHKEEDTDTKQVYFYLFKLLR
KCILQMSQPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSHLPPKERQTMYELSKMFLLCLN
YWKLETPSQFRQRSQNDDVATYKVNYTRWLCYCHVPQSCDSLPRYETTHVFGRSLLKSIF
TVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEEEIYGENSPIWEADFTVPAAEG
AQLVSRPAAVSTVTVPTTPLFSKKLSNSSSAASMDTSAPEPLPGEKRKLPESLTLEDAKR
IRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARDETARLEERRGIIEFHVIGNS
LSQKSNKKILMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRM
FPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQXX
ELNPRIPYTELSHIEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYP
GLTCFKEGVRQIPIESVPGIRETGWKPLGKEKGKELKDPDQLYNTLKNLLAQIKTHPSAW
PFMEPVKKSEAPDYYEIIRFPIDLKTMTERLKNRYYVTKKLFIADLQRIITNCREYNPPD
SDYCKCANTLEKFFYFKLKEGGLIDK
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggttctggaacactcccgtgggcgcaaggcgcaggtgcgggggttcccccgcgggaag
aagctggagaaactgggggtcttctcggcctgcaaggccaacgatgcctgtaaatgcaat
ggctggaagaaccccaaccctcccaccgccccccgcatggacctgnacctgagcgagccc
tgccggagctgcggccacgcgctggcggaccatgtgtcccacctggagaacgtctcggag
gaggagatcaaccggctgctgggcatggtggtggacgtggagaacctcttcatgtcggtg
cacaaggaggaggacacggacaccaagcaggtgtatttctacctgttcaagctgctgcgg
aagtgcatcctgcagatgagccagccagtggtggaggggtccctggggagcccccccttt
gagaaaccaaacatcgagcagggagtcctgaactttgtccagtacaagttcagccacttg
ccgccaaaggagcggcagacgatgtacgagctctccaagatgttcctgctctgcctcaac
tactggaagctggagacaccgtcccagttccggcagcgctcgcagaacgacgatgtggcc
acctacaaggtcaactacaccaggtggctgtgctactgccacgtgccgcagagctgtgac
agcctcccccgctacgagaccacccacgtctttgggcgcagcctcctcaagtccatcttc
acggtcacccgccggcagctgctggagaagttccgagtggagaaggacaagctggtgccg
gagaagcgaacgctgatcctcacccacttccccaagttcctgtccatgctggaggaggag
atttacggcgagaactctccaatctgggaggctgatttcaccgtgccggctgcagaaggt
gcccagctggtgtctcgtccagctgctgtcagcactgtcactgtgcccaccactccgctc
ttcagcaagaagctcagcaacagcagctccgctgcgagcatggacaccagcgccccagag
cccctgccaggggagaagcggaagctgcccgagagcctgacgctggaagatgccaaacgg
atccgtgtcatgggcgacatccccatggagctggtgaacgaggtcatgctgaccatcacg
gaccccgctgccatgctgggccctgagaccagcctgctgtcggcgaacgcggcgcgggac
gagacggcccggctggaggagcgccgcggcatcatcgagttccacgtcatcggcaactcg
ctctcgcagaaatccaacaagaagatcctgatgtggctggtgggcttgcagaacgtcttc
tcgcaccagctgccccgcatgcccaaggagtacatcactcgcctcgtctttgacccgaag
cacaagaccctggcgctgatcaaggacggccgggtgatcggggggatctgcttccgtatg
ttccccacccagggcttcaccgagatcgtcttctgcgccgtcacgtccaacgagcaagtg
aagggctacgggacgcacctgatgaaccacctgaaggagtaccacatcaagcacaacatc
ctctacttcctcacctatgcggacgagtatgccatcggctacttcaagaagcaggnnngt
gagctgaacccccgcatcccctacaccgagctctcccacatcgagggggcaaccctgatg
gagtgtgagctgaatccccgcatcccctacaccgagctctcccacatcatcaagaagcag
aaggagattatcaagaagctgatcgagaggaagcaagcgcagatccgcaaggtctaccct
ggcctgacctgcttcaaggagggcgtgcggcagatccccatcgagagcgtccccggcatc
cgagaaacgggatggaaaccgctggggaaggagaagggaaaagagctgaaggacccagac
cagctctacaacaccctgaagaacctcctggcccagatcaagacccaccccagcgcgtgg
cccttcatggagccggtgaagaagtcggaggcgccggattactacgaaatcatccgcttc
cccattgacctgaagaccatgaccgagcgcctgaagaaccgctactacgtcaccaagaag
ctgttcatcgccgacctgcagcgcatcatcaccaactgccgcgagtacaacccgcccgac
agcgactactgcaagtgtgccaacaccctggagaagttcttctacttcaagctcaaggag
ggggggctcattgacaagtag

DBGET integrated database retrieval system