KEGG   Columba livia (rock pigeon): 102085278Help
Entry
102085278         CDS       T02912                                 

Gene name
SRD5A2
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00140  Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102085278 (SRD5A2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     102085278 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Steroid_dh DUF1295 PEMT
Motif
Other DBs
NCBI-GeneID: 102085278
NCBI-ProteinID: XP_021148520
Position
Unknown
AA seq 165 aa AA seqDB search
LIYLRTFIYPFLTRGRPFPLQLLFFGTLFCIYNGFLQGYYLIYCAEYPNDWCTDIRFTSG
LLLFLLGMGINIHSDLLLRQLRKPGEVTYKIPQGGLFTYVSGANYFGEIVEWFGFAIATW
SLPAFAFAFFTLCCIGPRAYHHHRYYLKTFTDYPKSRKVLIPFVF
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
cttatctaccttaggacatttatttaccctttcctcactagaggcagacctttcccactg
caattgcttttctttggcacgttattctgtatctataatggcttcctccaggggtactac
ctgatttactgcgctgaatatccaaacgattggtgcaccgacatcagatttacatcaggc
ctcctcttgtttctgctgggaatgggaatcaacattcacagtgatctcctcctgcgtcag
ctgaggaaacccggggaagtcacttacaagattcctcaagggggactgttcacctatgtt
tctggagccaactactttggagaaattgtggaatggtttggttttgccatagcaacctgg
tccctaccagccttcgcctttgccttttttactctttgctgcatcgggccacgtgcttat
caccatcacaggtactatctcaagacatttacggactatccaaaatcaaggaaagtcttg
attccctttgttttttaa

DBGET integrated database retrieval system