KEGG   Columba livia (rock pigeon): 102085908Help
Entry
102085908         CDS       T02912                                 

Gene name
TGM6
Definition
transglutaminase 6
Orthology
K05624  
transglutaminase 6 [EC:2.3.2.13]
Organism
clv  Columba livia (rock pigeon)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 696 aa AA seqDB search
MADLTPTHISWQPSVNASTHHTDRYTSTELTVRRGQAFTITLYFNRPQQAGEHLAFVTEI
GPSPSESHRTRAVFNLSEVGASGWSATQGPSESGYTNFTISSPANAVIGRYNLILQVTSG
NKIISRFLGQFVLLFNPWCPGDDVYMANENERQEYVLNENGIIFVGNAKYIEARGWYYGQ
FQDHLLNVCLTMLDLSLYYRQDPAIDVSRRGDPKYVGRVISSMINGNDNDNGVLLGKWEG
SFHSHENPSRWDSSVVILQKWRQDNYKPVQYGQCWVFAGVMCTVLRCLGIPTRLVSNFNS
AHDVDRNLSIDKYYDSSGKSLNIGKDSTWDYHVWNESWFVRPDLGSSYNGWQVLDATPQE
QSKGLFQCGPASVVAIKEGDVNLDYDTLFVYTEVNADCNRWIVYSNGTKKRVYCDTEIIG
RFISTKAVGSNSRVDVTYNYKYPEGSPEERRVYKKALAKILGSNITAGHTESPAERSSET
LRNPGISGKFKLAEPPVFGKDVSLILILNNLSSDQKTVKVDMSASTVLYTRRAVTEILKA
TTSVDLGPKQGKHIRLNIPYSYYGKYLTTDKRIQVTALCEVMHMHGVKLLVEKTIILEDT
NIIIKIPRQAVVNRAVTLEISYANPLPEPVSRCVLLVTLMNQQVKINLAQLAPRERSKIY
FEFTPRRPGPLQLQVDFSCDKFSHVKGFATIAVAPA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctgacaccaacacatatcagctggcaaccatcggtaaatgcaagcacacac
catactgacaggtataccagcaccgagctgactgtgaggcgaggacaagctttcactatt
accctgtacttcaacagaccacagcaggctggagagcacctggcatttgtcactgaaata
ggaccatccccctcagaatcccatcgtacgagggctgtatttaacctctcggaggtgggg
gcaagtggctggagcgctacacaaggaccctccgagtccggctatacaaactttacaata
tccagcccagccaacgctgtcatcggacgatacaatctcatcctccaggtaacctcaggg
aacaagatcatctccagattcctagggcagtttgtgttactcttcaacccttggtgccca
ggtgatgatgtctacatggctaatgaaaatgagagacaagaatatgtgctaaatgaaaat
ggaataatcttcgtgggcaatgcaaagtacattgaagcaagaggatggtactatggacaa
tttcaagatcaccttctaaacgtctgtctcaccatgcttgatctgagcctgtactatcgt
caggacccagccattgatgtatcccgaagaggagatcctaaatatgtgggccgagtaatc
agttctatgatcaacggaaatgataacgataatggagttctcctgggaaagtgggaagga
agcttccattcacatgagaatccatccaggtgggacagcagcgtggtgatcctccagaaa
tggcgccaggacaactacaagcctgttcagtacggccagtgctgggtttttgcaggcgtg
atgtgtacagttctgaggtgcttggggattccaactcgtttggtttcaaattttaactct
gctcatgatgtggacagaaacctgagcattgataagtactatgacagctctggaaagagt
ctgaatatcggcaaggattccacatgggattatcacgtctggaatgaaagctggttcgtt
cgtccagacctgggaagctcatacaatggatggcaggttttagatgcaactccacaagaa
caaagcaaaggattatttcaatgtggccctgcatctgttgtagccatcaaagaaggcgat
gtaaacctggattatgacaccttatttgtgtacacagaggtgaatgccgattgcaacaga
tggattgtatacagtaatggaactaagaaaagagtttattgtgatactgaaataattggc
aggtttatcagcaccaaggctgtgggcagtaattcccgtgtggatgtcacctataattac
aaatatccagaaggttctcctgaggaaagacgagtttataaaaaggccttggccaagata
cttggatccaacatcacagcaggacacacagaatctccagctgaaagatcttcagagaca
cttagaaaccccgggatctctgggaagttcaagctggctgaacctccagtgtttggcaaa
gacgtttccctaatcttaatcctcaataatttgtcttctgaccagaagaccgtgaaggtg
gacatgagtgcgtcaaccgtcctctacacaaggagagcagtgacagagatcctgaaggca
accacttctgtggatctcggtcctaagcaagggaaacatatccggttaaatatcccttat
tcttattatggaaaatatctgactacggacaaaaggatccaagtcaccgctttgtgtgaa
gtcatgcacatgcatggggtgaagttgctggtggagaagacaatcattttagaggacaca
aacattatcattaagattcctcggcaggctgtggtgaacagagctgtcaccctagagatc
tcctacgccaaccccctccccgagcccgtgagccgctgtgtgctgctggtgaccctgatg
aaccaacaggtcaagataaatctggcacaactggcaccgagggagagatcaaaaatctat
tttgaattcacacctcgcaggcctgggcccttacagctgcaagtagacttctcttgtgac
aaattttcacatgttaagggatttgcaaccattgcagtagcacctgcataa

DBGET integrated database retrieval system