KEGG   Columba livia (rock pigeon): 102086104Help
Entry
102086104         CDS       T02912                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102086104 (NCOA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1398 aa AA seqDB search
MVKMSGLGENSLDSLSSESRKRKPLPCDTPGASLTCGGEKRRREQESKYIEELAELISAN
LSDIDNFNVKPDKCAILKETVKQIRQIKEQGKAVSNDDDVQKADVSSTGQGVIDKDSLGP
LLLQALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYGILHEEDRKDFLKNLPK
SSVNGVAWTNETPRQKSHTFNCRMMVKTSHDLLEDVGSLPDTRQRYETMQCFALSQPRAM
MEEGEDLQSCMICVARRITTAERAFPTNPESFITRHDLSGKLVNIDTNSLRSSMRPGFED
IIRRCIQRFLCHNDGQSWSNKRHYHEAYTQGHAETPLYRFSLADGTIVTAQTKSKLFRNP
VTNDRHGFVSTHFLQREQNGYRPNPNSVGQNVRTAVAGNASSAGALVTASPGHGLAAQSR
SYGLADPGAVGQLSSTRYGGPGSVGPASSGPGMQPSAYQNNSYGLTMSSPPHGSPGLTSN
QQNLMISPRNRGSPKMSSHQFSPVTGMHSPMGSASNTGNNTFSSSSLSALQAISEGVGTS
LLSTLSSPGPKLDNSPNMSVSQQSKTSTQESKSPSGLYCEQNQVESSICQSNSRDLLSEK
DSKEGNVEASESQRAPSESKGHKKLLQLLTCSSDDRGHSTASNSPLDSSCKESSTSVTSP
SGVSSSTSGGVSSSSNVHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTYHDVSN
TAPCGEGTVKQEQLSPKKKENNALLRYLLDKDDVKDPLSKELKPKVENVDNKMGQCSSST
VPTSSQEKETKIKPEPPEEMSGDLDNLDAILGDLTSSEFYNNAMSANGNNLGTKQALFQG
NALLGTRSPQSAQAARAPFARAVSLDSPGAAVRNVSAFSMLHKQNLMGGSPRMIENQENF
GANLGAPSRSVAVGQHPAADWALPSSKGSRAGPAAASVGRPGPEFSASLPRPAAGGSVPG
LPVRSSSIPGARPVLQQQMIHMRPNEMNIGMGGNPYGQAGPSHQPSSWPDNVLSMEPASR
GAQNRQLVRNSLDDLLCPAPSMEGQNDERALLDQLHTLLSNTDVTSLEEIDRALGIPELV
NQGQALEPKQDSFQGQESSVMIEQKPSLYGQPYQGQGAAMPGGFSSIQGQQPSFNSVMNQ
MSQQSSFPVQSMHPRASVMRPRTNAPKQLRMQLQQRLQGQQFMNQTRQALEMKMENPGGG
NTSVMRPVMQPQVGSQQGFLNAQMVAQRNRELISHHFRQQRMAMMMQQQQQPQAFSPPPN
VTASGSMDSALAGPPMAQVPAQQFPYPPNYGLSQQPDPAYSRVPSPPNPMITSRMGPAQN
PMMQHPQAAPMYPSPEMKGWPSGSMARSSFPQQQFSHQGNPAAYSMMHMNGSGGHMGQMN
INTMPMSGMPLGPDQKYC
NT seq 4197 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagatgagcggattaggagaaaactccttggatagcctgagcagtgagtcaagg
aaacgcaagccgttgccctgtgatacaccgggtgcaagtctgacctgcggtggcgagaag
cgtcggcgcgagcaggaaagcaaatacattgaagaactggctgaactgatatctgctaat
ctgagcgacattgacaattttaacgtcaaaccagacaaatgtgctattttgaaagaaacc
gtgaaacagattcgacagataaaagagcaaggaaaagcggtttctaatgatgatgatgtt
cagaaagctgatgtgtcttctacaggtcaaggagttattgataaggattctctgggacct
cttttattacaggcattggacggtttcctgtttgttgtaaatcgagatgggaacatcgta
tttgtgtcagaaaacgtcacacagtacctgcaatacaagcaggaagatttggttaataca
agtgtctatggcatcttgcatgaagaggaccggaaggactttcttaaaaacctacctaaa
tcttcagttaatggagttgcttggaccaatgaaaccccccgacagaagagtcacacgttc
aattgccggatgatggtgaaaacctcccatgatctcttggaagacgtaggcagcctcccg
gatacgcgtcaaagatacgaaacaatgcagtgctttgctttatctcagccgagagccatg
atggaggagggggaagatttgcagtcctgtatgatttgtgtggcacggcgtatcacgact
gcagaaagggcatttccgacaaacccggagagctttattacaagacacgatctttcaggc
aaacttgtcaacatcgacacaaactcattacggtcttcgatgagacccggctttgaggat
atcattcgtcggtgcattcagaggttcttatgccataatgatggacagtcgtggtcgaac
aaacgccactatcatgaagcttacacgcaaggccatgctgagacgccgttgtatcggttc
tctttagcggatggcaccatagtgacggcgcaaacaaaaagtaaactgtttcgaaaccct
gtgactaatgaccgccatggatttgtctctacccactttcttcaaagagaacaaaatgga
tatcggccaaaccctaactcagttgggcagaacgtcagaacagccgtggctgggaacgcg
agctctgccggcgctctggtgaccgcgtcccctggccacgggctggcagcgcagagcagg
agctacgggctggcagatcccggcgctgtggggcagctcagcagcacccggtacggaggc
cccgggagcgtggggccagcgagctctgggcccggcatgcagccctctgcgtaccagaac
aacagctacgggttaactatgagtagcccaccacatggtagtcctggtttaacttccaac
caacagaatctaatgatatctcctaggaatcgagggagtccaaaaatgagttcgcaccag
ttttctccagttacaggtatgcactctcccatgggatctgccagcaacaccggcaacaac
acgttctctagcagttctcttagtgctcttcaagccattagtgagggtgttggaacttcc
cttttatcaacactttcttcaccgggtccaaaattggataattccccaaacatgagtgta
tctcagcaaagtaaaacaagtacccaggagtccaaaagcccttctggtttgtactgtgaa
cagaaccaagtggaaagttccatctgccagtcaaacagcagggatctcctcagtgagaaa
gacagcaaagagggcaatgtggaggcatctgaaagtcagagagcgccatctgaaagcaaa
gggcataaaaaactgcttcagctactcacgtgctcctcagatgacagaggccattctaca
gcttcaaactcccctttggactccagctgtaaagaatcctccaccagcgttaccagcccg
tccggagtttcctcgtccacgtcggggggggtatcttcctcctcgaacgtgcacgggtcg
ctcctgcaggagaagcatcgcattttgcataaattgttacagaacggtaattctccagca
gaggtagccaagatcacagccgaagctactggtaaagacacgtatcatgatgttagtaat
acagccccttgcggagaaggcaccgtcaaacaggagcaactgagcccaaagaagaaggaa
aacaatgctttactgaggtatctgttagataaagatgatgtgaaggacccactttccaaa
gagctgaagcctaaagtagaaaatgtggataataaaatgggacaatgcagtagttctaca
gttcctacttccagtcaagaaaaagagacaaagataaaaccggaacccccagaggagatg
agtggtgacttggataatttggatgcaattctaggtgatctgactagttcagagttttac
aataatgcgatgtctgcaaatggaaataaccttggaacaaagcaagcattatttcaagga
aatgcactgttgggcacgaggagtccccagtcggcgcaggctgcccgcgcgcccttcgcc
agggccgtgtctctggacagcccgggcgctgcggtcaggaacgtcagcgcgttctccatg
ttacacaagcagaacctgatgggtggaagtccaaggatgattgaaaaccaggagaatttt
ggagcaaatctgggtgctcccagcagaagtgtcgcggtgggtcagcacccggcggcagac
tgggctttgccgagctccaagggcagcagagcggggcctgctgccgcgtccgtgggcagg
ccggggcccgagttcagcgcgtcgctccccaggcccgcggccggcggctccgtgcccggg
ctgcccgttcgctccagcagcatccccggtgcgcggccagtgctgcagcagcagatgatt
cacatgaggccgaatgagatgaacatcggcatgggggggaatccgtatggacaggcagga
ccgtctcaccagcccagctcgtggcctgacaacgtgctgtccatggagccagcatcgcgg
ggggcgcaaaacagacaattagttagaaactctttggatgacctcttgtgtccggcaccc
agtatggaaggccagaatgatgaaagggcccttttggatcagctgcacacgttgctgagc
aatacggacgtcacgagtctggaagaaatcgacagggcgttaggaattcctgagctcgta
aaccaaggacaagctttggaacccaaacaagattcgtttcaaggtcaggaatcttcagtt
atgattgagcagaagccttcgttatatggtcagccctaccaagggcaaggggcagcaatg
cccggaggtttcagcagcattcagggacaacagccgtccttcaattcggtgatgaatcag
atgagccagcagagcagtttcccagttcagagcatgcatcccagggcaagcgtgatgagg
cctcgaaccaatgcaccaaagcagctccgcatgcagctccagcagcggcttcaggggcag
cagtttatgaatcagacccgtcaagcgcttgaaatgaaaatggaaaatccagggggtggc
aatacctccgtgatgagaccagtcatgcagccacaggtgggatcacagcaaggttttctt
aatgctcaaatggtggctcagcgtaacagggagctaataagtcatcattttagacaacag
aggatggcaatgatgatgcagcagcaacagcagcctcaggccttcagccccccgccaaac
gtgacagcctcaggaagcatggacagtgccctggccggccccccaatggctcaagttcct
gcacagcagttcccctacccacccaattacggactaagccaacaaccggaccctgcgtat
agcagagtaccgagccctcccaaccccatgatcacgtcaagaatgggacccgcccagaac
cccatgatgcagcacccccaggcagcacccatgtacccgtccccggagatgaagggctgg
ccctcgggcagcatggccaggagcagcttcccccagcagcagttcagccaccaaggcaac
ccagccgcgtacagcatgatgcacatgaacggcagcggtggccacatgggacagatgaac
attaataccatgccgatgtcggggatgcctctgggtccagaccagaagtactgctga

DBGET integrated database retrieval system