KEGG   Columba livia (rock pigeon): 102086880Help
Entry
102086880         CDS       T02912                                 

Gene name
GAD2
Definition
glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa)
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Module
GABA (gamma-Aminobutyrate) shunt
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:clv00650]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:clv00250]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:clv00410]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:clv00430]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 557 aa AA seqDB search
MSGQAARAWCQVAQKFTGGIGNKLXKPVETGARAAPGAAEPRPACTCDKKPCGCQKAEVN
YAFLHSTDLLPACNGEITTMSFLQDVVDILLQYVVKSFDRSTKVIDFHYPNELLQEYNWE
LADQPQTLEEILLNCRTTLKYAIKTGHPRYFNQLSTGLDMVGLAADWLTSAANTNMFTYE
IAPVFVLLEYVTLRKMREMIGWPGGCGDGIFSPGGAISNMYAMLIARFKMFPEVKEKGMA
AIPRLVAFTSEHSHFSVKKGAAALGIGTDSVILIRCDERGKMIPSDLERRILEAKQKGFV
PFLVSATAGTTVYGAFDPLIAIADICKKYKIWMHVDGAWGGGLLMSRKHKWKLNGVERAN
SVTWNPHKMMGVPLQCSALLVREEGLMQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGR
HVDVFKLWLMWRAKGTTGFEAQIDKCLELAEYLYNKIKNREGYEMVFDGKPQHTNVCFWY
IPPSLRSMEDNEERMSRLMKVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATH
QDIDFLIDEIERLGQDL
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggcaggcagccagagcctggtgtcaggttgcccagaagttcacgggagggatc
ggaaacaaacttnngaagcccgtggaaaccggcgccagggcagccccgggggcagcggag
ccgcggccggcatgtacctgcgacaaaaagccctgcggctgccaaaaagcggaggtgaat
tacgcctttctgcactcaacagatcttctgccagcatgcaatggagaaataacaacgatg
tctttcctacaagacgttgtggacattttacttcagtatgtggtgaaaagttttgataga
tcaacaaaagtcattgatttccattacccaaatgagctgctccaggaatataactgggaa
ctggcagaccagccacagaccttggaagaaattttattgaactgcagaacaactctgaag
tatgcaattaaaacagggcaccctagatattttaatcaactttcaactggattggacatg
gttggattggcagcagactggctgacatcagcagcaaatactaatatgttcacctatgaa
attgctccagtgtttgtacttttggaatatgtcacactaaggaaaatgagagagatgatt
ggctggccagggggctgtggcgatgggatattttcacctggtggtgccatatctaacatg
tatgctatgttgattgcacgtttcaagatgttcccagaagttaaagaaaaaggaatggca
gctattcccagactggttgccttcacatcagaacatagtcacttttccgtgaagaaagga
gctgcagccttgggtattggtacagatagtgtgattctgattagatgtgatgaaagaggg
aaaatgatcccatcagaccttgaaagaagaattcttgaagccaaacaaaaaggattcgtt
ccttttctggtgagtgcgacggctgggacaacagtgtatggggcatttgatcccctcata
gctattgcagacatttgtaagaagtacaaaatctggatgcatgtggatggagcatggggt
ggtgggctcctgatgtcaagaaaacacaaatggaagttaaatggcgttgaaagggccaat
tcagtgacctggaaccctcacaagatgatgggcgtcccactgcagtgttcagccctgctt
gtaagagaagagggattgatgcagagttgcaatcaaatgcatgcttcctacctctttcaa
caagacaagcactatgacctgtcttatgacacaggagacaaggctttgcaatgtggacga
catgttgatgtcttcaagctatggctgatgtggagggcaaagggaaccacagggtttgaa
gcacaaattgataagtgcttggagcttgcagaatacctatacaataaaataaagaacaga
gaaggctatgaaatggtgtttgatggaaagcctcagcacacaaatgtctgcttctggtat
atacctcccagcttgcgcagtatggaagacaatgaagaaagaatgagccgccttatgaag
gtggcaccagtgataaaagccaggatgatggagtatggcacgaccatggtgagctatcag
cctctgggagacaaagtgaacttcttccgcatggtcatctcaaaccctgcagcaactcac
caagacattgatttcctgattgatgaaatagaacgcctgggacaagatttataa

DBGET integrated database retrieval system