KEGG   Columba livia (rock pigeon): 102086952Help
Entry
102086952         CDS       T02912                                 

Definition
pancreatic alpha-amylase-like
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102086952
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102086952
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 535 aa AA seqDB search
MNCRSSKEYKLAVERPQLYTEGTMQVLLLLAAVGVCWGQYNPNVQAGTTSIVHLFEWRWA
DIALECERYLAPYGFGGVQVSPPNENIVITSPYRPWWERYQPISYKICTRSGNEDEFRDM
VSRCNNVGVRIYVDAVVNHMCGSAGGSGTHSTCGSYFNAGSEDFPAVPYSGWDFNDGKCH
TGNGEIQNYGDIYQVRDCRLSGLLDLALEKDYVRTKIADYMNHLIDIGVAGFRIDAAKHM
WPGDIKAFLDKLNNLNTRWFSEGTRPFIFQEVIDLGGEPITSSEYFGNGRVTEFKYGAKL
GTVIRKWNGEKLSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYK
MAVGFMLAHPYGFTRVMSSYRWPRSFVNGQDVNDWIGPPSYSDGTTKPVTINADTTCGND
WVCEHRWHEIRNMVVFRNVVDGQPFSNWWDNGSNQVAFGRGSKGFIVFNNDDWHLNTDLQ
TGLPAGTYCDVISGDKEGNRCTGTQVYVSGDGMANFQISNSAEDPFIAIHVGAKL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaattgtcggtcgtctaaggagtataaattggcagtggagagaccacagctttatact
gaaggcaccatgcaagtccttctgctgctcgcagctgtgggggtgtgctggggtcagtac
aaccccaacgttcaggccgggacgacatctatcgtacatctctttgaatggcgctgggcc
gacattgctcttgagtgtgaacgctatttagctccttatggatttggaggagttcaggtt
tctcctccaaatgaaaatattgtcattactagcccttacagaccctggtgggaaagatac
cagcccatcagctacaagatctgtacccgatcgggaaacgaagatgaattcagggacatg
gtgagcagatgcaacaacgttggggttcgtatttatgtggatgctgttgtcaaccacatg
tgtgggtctgcaggtggctcaggcacccattccacctgtgggagctattttaatgctggg
agtgaagattttccagctgtgccgtactcaggctgggatttcaatgatggcaaatgtcac
actggaaatggagaaattcagaattacggtgatatatatcaggttcgggactgtcgcttg
tctggccttcttgatctggccctggagaaggactatgtgcgcacaaaaattgccgattac
atgaaccatctcatcgatattggtgtagcaggcttccgaattgatgctgccaagcatatg
tggcctggggacataaaagcatttctggacaagctgaacaatctaaatactagatggttt
tctgaaggaacgagacctttcattttccaggaggtaattgacttgggcggagagccgatc
acaagcagtgagtactttggaaatggccgagtgacagagttcaaatacggtgcaaaactg
gggacagtgatccgcaagtggaacggagaaaagctgtcctacttaaagaactggggagaa
ggctggggctttgtgccttctgacagagccctggtctttgtggataatcacgacaaccag
cgtgggcacggcgccggcggagcttccattctaaccttctgggatgccaggctttataaa
atggcagttggtttcatgcttgctcatccgtatgggttcacccgtgtgatgtcaagttat
cgctggccaagatcttttgtaaatggacaggacgtcaatgactggattggacccccaagc
tactcagatggaaccacgaagcctgttacgatcaatgcagacactacctgtggcaacgac
tgggtttgtgaacatcgctggcatgaaataaggaacatggttgtcttccgtaatgtggtg
gacggtcagcctttctccaactggtgggacaacggcagcaatcaagtagcttttggccgt
ggtagtaaaggcttcatcgttttcaacaatgatgactggcatctgaacaccgatttgcaa
actggcctgcctgctggtacctactgtgatgttatttctggagacaaagagggcaacaga
tgtactggaacacaggtgtacgtttctggtgatgggatggctaatttccagattagcaac
agtgctgaagatccattcattgcaattcacgttggtgccaagttataa

DBGET integrated database retrieval system