KEGG   Columba livia (rock pigeon): 102087078Help
Entry
102087078         CDS       T02912                                 

Gene name
KAT6B
Definition
K(lysine) acetyltransferase 6B
Orthology
K11306  
histone acetyltransferase MYST4 [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102087078 (KAT6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 2024 aa AA seqDB search
MVKLANPLYTEWILEAIQKVKKQKQRPSEERICHAVCASHGLDKKTVSEQLELSVQDGSI
LKVTNKGLASYKDPDNPGRFSSVKPGTIPKSVKGSRGACNELRNVDWNKLLRRAIEGLQE
PNGSSLKNIEKYLRSQNDLANIFNSPAFQQRLRLGAKRAVNNGRLLKDGPQYRVNYGSLE
SKGVPKYSSTFPASLPPVSLLPHEKDQPRADPIPICSFCLGTKESNREKKPEELLSCADC
GSSGHPSCLKFCPELTTNVKALRWQCIECKTCSACRIQGKNADNMLFCDSCDRGFHMECC
DPPLSRMPKGMWICQVCRPKKKGRKLLHEKAAQIRRRYAKPIGRPKNKLKQRMLSVTSDE
GSMNAFTGRGSPGRGQKTKVCTTPSSGHAASVKDSSSRLPVTDPTRPGATTKITTTSTYI
SASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKKVSQKQSCTSLVLA
TGTTQKLKPPPSSLLPPTPISGQSPSSQKSSTSTSSNSPHSSSSRSSVPSFSGLPSNSQI
KGLFDGLSHIYTTQGHSRKKGHPSYAPPKRLRCKPDLSSTSKSNSHFYGKKAVRSRFISR
TFGWGVSRGHAFKAIAHLKRAAFLKKHRILGRIKYKVTPQMGTPSPGKGSLADGRIKPDQ
DDDTEIKLSIKQENTDIFLVGSKVTVTQEDLEVFKQARELSLEKIGCKNGGETSGRYPSV
IEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIY
RRNDLSVFEVDGNVSKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVLTKNDEKGCHLVGY
FSKEKLCQQKYNVSCIMIMPQYQRQGFGRFLIDFSYLLSRREGQAGSPEKPLSDLGRLSY
LAYWKSVILEYLNCHHEKQISIKGMSRATGMCPHDIATTLQQHSMIDKREDRFVIIRREK
LISSHMEKLKANPRINEVDPESLRWTPLLVSNAAVSEEEREAEKEAERLMEQASCWEKEE
QDIFSTRTNSRQSPAKVQSKNKYLRSPESVAVVGERGQSAEQSKESSEEDGGDENQQSSP
PRLTKPQSLAMKRKRPFILKKKRGRKRRRINSSVTTETISETTEVLNEPFDNSXXXXXXX
XXXTCEMDGEDDDLKPVIRKAFDYQPGQQKQEKEEDEEQSKEEKSICCYRSDDNCTNNTE
DAAVSEESTKDNLEPLKGKQGWPKGVKRGPSKWRQSKERKPGFKLNLYTPPETPMEPDYQ
VLVEEQKEVADNKPCSVPAVMEEEIKEPVELLPPPDDEVKEVEPEPVCPPCEPFEKQEND
MMKAGEEERDLEEGEVNSKDREKDKADEVFLQKEESLHLDDQDEEEEEDEEPSHNEDHDA
DDEDDSHMGSTEVEKEELPGEAFKEMLETQQSFLDVNVQNGNSNQEDLMDCGVDLAADEC
ESDQKELAADSDPVPESDDDHTDNNQDQKADEELHSSFKGESTETMEIDSETVQAVQSLT
QEASEHEDTFQDCAETQEACRSLQNYAHNDQSPQMTTLDDCQQSDHSSPVSSVHSHPSQS
VRSVNSPNVAPLENSYAQISPDQSAISVPSLQNMETSPMMDVPSVSDHSQQVVDSGFSDL
GSIESTTENYENPSSYDSTMGSSICGNNSSQNSCSYSSLTSSNLTQSSCAVTQQMSNMNG
SCSMMQQTNINSPPTCNVKSPQGCVVERPPSSNQQLSQCSMAANFTPPMQLTEIPETGNT
NIGLYERMGQSEFGAGHYSQPSATFSLAKLQQLTNTLMDHSLPYSHSAAVTSYANSASLS
TPLSNTGLVQLSQSPHAVPGGPQAQATMTPPPNLTPPPMNLPPPLLQRNMTSSNIGISHT
QRLQTQMASKGHVSVRTKSTPLPPAAAAHQPQIYGRTSQTVAMQGPTRTLTMQRGMNMSV
NLMPAPAYNVNSVNMNMNTLNAMNGYSMSQPMMNSGYHSNHGYMNQTPQYPMQMQMGMMG
TQPYAQQPMQTAPHSNMMYTPPGHHGYMNTGMSKQSLNGSYMRR
NT seq 6075 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacttgccaaccctctttatacggagtggattcttgaagctatacaaaaagtt
aaaaagcagaaacaaaggccttctgaagagagaatatgtcatgctgtttgtgcttcccat
ggattagataagaagactgtttcagaacagttggaacttagtgttcaagatggttctatt
cttaaagttaccaacaaaggccttgcgtcctacaaggacccagataatcctggacggttt
tcatctgttaaacctggcactattcctaaatctgttaagggatctagaggagcttgtaat
gagcttcgtaatgtggattggaataaactcttgagaagagcaattgaagggcttcaagaa
ccaaatggctcctccctgaaaaacatagagaagtacttgagaagtcaaaatgacctagca
aatattttcaacagccctgcctttcagcagaggttgcgtctaggggccaaacgtgctgtg
aacaatgggcgattactgaaggatggacctcagtatagagtgaattatggcagtttggaa
agcaaaggagtaccaaaatactccagcactttcccagcttctcttccacctgtcagcctt
ctcccccatgaaaaagaccagccacgagctgatcccatcccgatatgtagcttttgtttg
ggaacaaaggaatcaaatcgtgaaaaaaagccagaagagctgttgtcttgtgcagactgt
ggcagcagtggacatccatcatgtttgaaattctgtccagagttaacaacaaatgtgaag
gccttaagatggcagtgtattgaatgcaagacatgcagcgcatgtaggatccaaggcaaa
aatgcagataacatgcttttttgcgactcttgtgatagagggttccacatggagtgctgt
gacccgccactttcccgaatgccaaaagggatgtggatttgccaggtctgtagaccaaag
aagaaagggagaaagctgcttcatgagaaagctgcccaaataaggcgacgatatgcaaaa
cctattggacgaccgaaaaataaactaaagcaacgaatgttgtctgtaaccagtgatgaa
ggatccatgaatgcattcacaggaagggggtcacctggtaggggtcaaaagactaaagtc
tgtaccacaccttcatctggtcatgctgcatctgtgaaggattcaagcagcagattgcct
gttacagaccccactcggcctggtgccaccaccaaaatcaccaccacctccacctacata
tctgcctctacacttaaagttaacaagaaaaccaaagggctcattgatggccttactaag
ttctttacaccatcacctgatggtcgcagatcacgaggtgaaataatagacttttcaaag
cactatcgtccaaggaaaaaggtctctcagaaacagtcatgcacttctcttgtgttggct
acaggtaccacacaaaagctaaaacctccaccttcttcacttctacccccaacccccatc
tctggtcagagccctagttcacaaaaatccagcacttccacttcttctaactctccccac
agttcttccagtaggtcaagcgtgccctcctttagtggccttcctagtaacagtcagata
aagggacttttcgatggactctctcatatctataccactcagggacattctcggaaaaag
ggacacccaagctatgcaccacccaagcgtttgcgttgtaaaccagacttatcttccaca
tcaaaatctaatagccatttctatggaaagaaagctgttaggagtaggtttatttctcgt
acctttggatggggtgtgtctagaggacacgcttttaaagcaattgctcacctcaagagg
gcagctttccttaaaaagcacaggattctaggcagaataaagtataaagtgacccctcag
atggggaccccctcaccagggaaggggagcttggcagacggaaggattaaacctgatcag
gatgatgatactgaaatcaaactaagcatcaagcaggagaatacggatatatttctggtg
ggaagcaaggtcactgttacacaggaggatttggaagtatttaagcaggctcgagagctt
tccctggagaaaattggttgtaaaaatggtggtgaaacgagtgggcgatacccttctgtg
attgagttcggaaaatacgagatacagacctggtactcttcaccttacccacaggaatat
gcaagattaccaaagctttacctgtgtgaattctgtcttaaatacatgaaaagtaaaaac
attttgttgaggcactcaaagaaatgtggctggtttcatcctccagccaatgaaatctac
agaagaaatgacctttctgtatttgaggttgatggaaatgtgagcaaaatttattgtcag
aatctttgtttgttagctaagctctttctggaccacaaaaccttgtattatgatgttgaa
ccattcctcttctatgtccttacaaaaaatgatgagaaaggctgccatttagttggatat
ttctctaaggaaaagctttgccagcagaagtacaatgtctcctgcataatgattatgccc
caataccaaaggcaaggatttggaaggtttctcatcgatttcagctatttactttctaga
agagagggtcaagcaggatcccctgaaaagccattgtctgatctgggtcgtctctcatac
ttggcttactggaaaagtgtcatattagaataccttaactgccaccatgaaaaacaaatc
agcatcaaaggaatgagtcgagctactggaatgtgtccacatgatattgccacaaccctg
cagcaacatagcatgatagataaaagagaagatagatttgtaattattagaagagaaaag
ctgatttcgagtcacatggagaaactgaaagcgaatccacgtatcaatgaagtagatcct
gaaagcttgaggtggactcctttgttagtttctaatgctgcagtttctgaagaagagaga
gaagcagaaaaggaggctgagcgtctgatggaacaagctagctgctgggaaaaggaagag
caagacatattctccacgagaactaatagtaggcaatcacctgcaaaagtacaatctaaa
aataaatatttgcgatctccagaaagtgtggcagtagtgggggagcgagggcaatcggca
gagcaatccaaggaaagcagcgaggaggatggcggggatgagaatcagcagagttcacct
ccccggctgacaaagccacagtcactggccatgaaaagaaagagacctttcatactgaaa
aagaagagaggccgtaaacgcagaaggattaatagcagtgtaacaacagagacaatttct
gaaacaacagaggtgttgaatgaaccatttgataactcagannnnnnnnnnnnnnnnnnn
nnnnnnnnnacttgtgagatggatggggaagatgatgacttgaagcctgtaattagaaaa
gcttttgattatcaacctgggcagcagaaacaggagaaggaggaggatgaagagcagagc
aaggaggagaaaagcatttgttgttacaggagtgatgacaattgtacaaataatacagag
gatgcagctgtgtcggaagaaagcactaaagacaatcttgaacctttaaagggtaagcag
ggttggcctaaaggagttaagcgtggtccatctaaatggaggcaaagcaaagaaagaaaa
cctggctttaagcttaatttatacactccacctgagactcctatggagcctgactatcag
gtgttggtggaggaacaaaaggaggtagctgacaacaagccctgctcagttcctgctgtt
atggaggaagagattaaagagcctgttgaactattgccaccaccagatgatgaggtaaaa
gaggtagaacctgaacctgtgtgtccaccctgtgaaccctttgaaaaacaagaaaacgat
atgatgaaagctggggaagaagaaagggatttagaagaaggtgaagtgaattcaaaagat
cgagaaaaagacaaagcagatgaggtgtttctgcaaaaagaagagtccctgcatttggat
gatcaggatgaagaagaggaggaggatgaagaaccttctcacaatgaggatcatgatgca
gatgatgaagatgatagccacatgggttcaacagaagtggagaaagaggagttgcctggt
gaagctttcaaagaaatgctggaaacacagcaatcttttttagacgtaaatgttcaaaat
ggtaattcaaatcaagaggacttaatggattgtggggttgaccttgcagctgatgagtgt
gaaagtgaccagaaagaacttgctgcagattcagacccagtgcctgaatctgatgatgat
cacacagataacaaccaggaccaaaaagctgatgaagaattacattccagtttcaagggt
gagagtactgagaccatggagattgattcagagactgttcaagcagtacagtctctaact
caagaagcaagtgaacatgaagatacgtttcaggactgcgcagagactcaggaggcctgt
agaagtttgcaaaactatgcccataatgaccaaagtccacaaatgaccacactggatgat
tgtcagcagtctgatcacagtagccctgtttcatctgtgcactctcatcccagccagtca
gttcgttctgttaatagtccaaatgttgctcctttagagaacagctatgctcagatcagc
ccagatcaaagtgccatttctgtgccgtctctacagaacatggagaccagccccatgatg
gatgttccctcagtttctgatcattcgcaacaagttgtggatagtgggtttagtgacttg
gggagcattgagagcacaacagaaaactacgaaaacccaagcagttatgattctacaatg
ggtagtagtatctgtggaaacaattcttctcaaaacagttgctcgtacagtagccttaca
tctagtaacctaacccagagtagctgtgcagtgacacagcagatgtctaacatgaatgga
agctgcagtatgatgcaacaaacaaacatcaactctcctcccacttgtaatgtaaaatct
ccccaaggctgtgttgttgaaaggcctcccagcagcaaccaacagttatcccagtgcagc
atggccgccaattttacaccacctatgcagttaactgaaatccccgagactggcaatacc
aacattggattgtatgaaagaatggggcagagcgaatttggagcggggcattactcacag
ccatctgccaccttcagccttgccaaactgcaacagttaactaacacgcttatggatcat
tccttgccttacagccattcagctgctgtaacttcctatgcaaacagtgcctctttgtcc
acccccttgagtaatacagggcttgttcagctttctcagtctccacatgctgttcctgga
ggacctcaagcacaggctaccatgacccctccccccaacctcactcctcctcctatgaat
ttgccacctccccttttgcagcgtaacatgacttcatcaaatattggaatatcccacacc
caaagactgcagactcagatggccagcaaaggtcatgtttctgtaagaaccaaatccacg
cctctgccacctgctgctgcagcccatcagccacaaatctatgggcgtacttcgcagact
gtggccatgcaagggcccacacggaccttgacaatgcagcgtggtatgaacatgagtgta
aatttgatgccagccccagcttacaatgtcaattcagtgaacatgaatatgaataccctt
aatgctatgaatggttatagtatgtcccagccgatgatgaatagtggatatcacagtaat
catgggtatatgaatcaaacaccccagtaccctatgcagatgcagatggggatgatggga
actcagccatacgcacagcaaccaatgcagacagcaccccacagtaacatgatgtacact
cctccagggcatcatggctacatgaatacaggcatgtccaaacagtctcttaatggatcc
tacatgagaaggtag

DBGET integrated database retrieval system