KEGG   Columba livia (rock pigeon): 102087081Help
Entry
102087081         CDS       T02912                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
clv  Columba livia (rock pigeon)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    102087081 (CLOCK)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102087081 (CLOCK)
Transcription factors [BR:clv03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    102087081 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 853 aa AA seqDB search
MFFTISTHKMSSIADRNDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGNIIYVSESITPLLEHLPSDLVDQSVFNFIPEGEHSEIYKILSSHLLESDSL
TPEYLKSKNQLEFCCHILRGTIDPKEQPTYEYVKFIGNFKCLNNVPNSAHNGFEGTIQRS
HRPSYEDKVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLDNLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPEITADKSQDSGSDNHINTVSLKEA
LERFDTSPTPSASSRSSRKSSHTAVSDHSSTPTKMTVDTSTPPRQSLSGHEKTAQRRSSL
SSQSLSSQSLGQPVTQPAMSQPATLQLQSGMSQPVFQFSAQLGAMQHLKDQLEQRTRMIE
ANIHRQQEELRKIQEQLQIVHGQGLQMFLQQSTSGLNFGSVQLASGNSSNVQQLTPINMQ
GQVVQTNQTQSGMNTGHISTPHMIQQQPLQNTATQHNQQNVLSGHNQQSSLASQSQNTVS
APLYNTMVISQPTTGNVVQVPSSLPQNNNQNAAAVTTFTQDRQIRFSQGQQLVTKLVTAP
VACGAVMVPSTMFMGQVVTAYPTFAAQQQQPQTLSVTQQQQQPSQADQQQQQLSTAQQPA
QPQLTQHPQQFLQTSRLLHGNQSAQLILSAAFPLQQSTFTQSHHQQHQSQQQQQQLPRHR
TDKMTDPSKVQPQ
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atgttttttaccataagcacccataaaatgagctccattgcagacagaaatgatggaagc
atttttgatgggctggtggaagaagatgacaaagataaagcaaaaagagtgtctagaaac
aagtccgaaaagaaacgtcgagatcagtttaatgttcttatcaaagagctgggttccatg
cttccaggtaatgctcggaagatggataaatccactgtactgcagaagagcattgacttt
ttacggaagcacaaagaaattactgcacaatcagatgccagtgagattcgacaggactgg
aaaccgacattccttagtaatgaagagttcacacagttaatgttagaggctcttgatggt
ttttttttagcaattatgacagatggaaacataatatatgtgtctgaaagtataactccc
ttacttgaacatttgccatctgaccttgtggatcagagtgtatttaattttatcccagag
ggggaacattcagaaatttataaaatattgtcgtctcatctgctggaaagtgattcattg
acaccagaatacttaaaatcaaaaaatcaactagaattctgttgccatatactgcgaggg
acaatagatccaaaagagcaacctacgtatgaatatgtaaaatttataggaaatttcaag
tgtttgaataatgttcccaactcagcgcacaatggttttgaaggaactattcagcgatcg
catcggccttcatatgaagacaaagtttgctttgtagccacagttagattagctacacct
caattcatcaaggaaatgtgcactgttgaagaacccaatgaagagttcacatctagacat
agcttagaatggaagttcctattcttggatcacagggcacctccaataataggttatctt
ccatttgaagttttgggaacatcaggctatgattattatcatgtggatgatctagataat
ctggcaaaatgtcatgagcatttaatgcaatatgggaaagggaagtcatgttactacaga
ttccttacaaagggacaacaatggatttggctgcaaacacattactatatcacgtatcac
cagtggaattccaggccagagtttattgtctgtacgcacactgttgtaagttatgcagaa
gttagagcagaaagacgacgagaacttggtattgaggagtctcttccagagataacagca
gataaaagtcaggactctgggtctgacaatcacataaacacagtgagtctcaaagaagcg
ctggaaagatttgataccagccccacaccttctgcttcctccaggagttcaagaaaatct
tcacatactgcagtgtcggatcattcatcaacacctactaagatgacagtggacactagc
actcctccaaggcaaagcttatctggtcatgaaaagactgcgcaaagaagatcatctctg
agtagtcagtctttgagctcccagtctcttggacaaccagtaacacagccagcgatgtct
cagcctgcaacgttacagctccagtctggcatgtcccagcctgtgtttcagttttcagct
caattaggagctatgcaacatctaaaggaccagctagagcaaagaacacgaatgatagag
gcaaatattcatcggcagcaggaagagttgcgtaagattcaagagcagcttcaaattgtc
cacggtcaagggctccagatgttcttgcagcaatcaacttctggactcaactttggttct
gtgcagcttgcttctggaaattcttcaaatgttcagcagcttacgccaataaacatgcaa
ggtcaagttgttcagactaatcagactcaaagtgggatgaacacgggccatataagtact
ccacacatgatacagcaacagcctttgcagaatactgcaacacagcataatcaacaaaat
gtactaagtggacacaatcaacagtcttctcttgccagtcagtcacagaacacagtctcg
gcacctttgtataacactatggtgatttctcagccaacaacaggaaatgtggtccaggtt
ccttccagcttaccacagaacaataaccagaatgctgctgcagtaaccacttttacacag
gacaggcaaatcagattttctcaaggtcagcaacttgtaacaaaacttgtcacggccccg
gtagcatgtggagcagtaatggtaccaagtactatgtttatgggacaggtggtgacagct
tatcccacttttgctgcccaacagcagcagccacagactttgtcagtaacgcaacagcag
cagcagccaagtcaggcagaccagcagcagcagcagctcagcacagctcagcaaccagct
cagccgcagctgacccagcaccctcagcagttcctacagacctccaggttacttcacgga
aatcagtcagctcagctcatcctctctgctgctttcccactacagcaaagcacttttact
cagtcgcaccaccagcagcatcagtctcagcagcagcagcagcaacttccgcgacacaga
actgacaagatgactgatccttccaaagttcagccacaatag

DBGET integrated database retrieval system