KEGG   Columba livia (rock pigeon): 102087342Help
Entry
102087342         CDS       T02912                                 

Gene name
ST6GAL2
Definition
(RefSeq) LOW QUALITY PROTEIN: beta-galactoside alpha-2,6-sialyltransferase 2
  KO
K00779  beta-galactoside alpha-2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00510  N-Glycan biosynthesis
clv00514  Other types of O-glycan biosynthesis
clv01100  Metabolic pathways
Module
clv_M00075  N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    102087342 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    102087342 (ST6GAL2)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-(2,6)-sialyltransferase
     102087342 (ST6GAL2)
Glycosyltransferases [BR:clv01003]
 Terminal extension
  Sialyltransferase
   102087342 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 102087342
NCBI-ProteinID: XP_005505894
UniProt: A0A2I0MSQ8
Position
Unknown
AA seq 559 aa AA seqDB search
MKLSRRGVCIQVSFSFTNTSRHRGAGKGIAMKPNLKQWKQLMLFGIFAWGLLFLVIFIYF
TDSNXXXXXPSSFSYTETKRLLPLQGKQRVIMGAIHDPSFSETIDGNEVLLNEDLLGSFK
SGTGSIKKWTDLEDAFRNEDEFFPSQIGRKSKSAFYQVNDDYLFAAGQPRLHNHLQEIAK
FISTDEDNPKANILQNNWSHQRRMKRRSTKHRRSQMLDESDDWDGLYSTMSKSFLYKLWK
GDVSSKMLNPRLQKAMKDYLSTNKHGVRFKGKRNSKLTGDQLFCELKERVNVKTIDGKEA
PFSTLGWEKHVPQIPLGKLYTHGFGSCAVVMSAGAILNSSLGDEIDSHDAVLRFNSAPTR
GYEKDVGNKTTMRIINSQILTNPNHHFVDSSLYKDVILVAWDPAPYSANLNVWYKKPDYN
LFTPYVQHRRKNPNQPFYILHPKFIWQLWDIIQENTKEKIQPNPPSSGFIGILIMMSMCN
EVHVYEYIPSVRQTDLCHYHELYYDAACTLGAYHPLLYEKLLVQRMNKGLQDDLYRKGKV
ILPGFKAVKCPKRNNFPHL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttccaggcgtggtgtctgcatccaggtttcattttccttcaccaatacttca
aggcacagaggagctggtaaaggcattgccatgaaacctaacttgaagcaatggaaacaa
ctcatgctgtttggcatctttgcatggggtctgctttttctggtgattttcatctatttt
acagatagcaacnacnnnnnnnnnnntcctagttccttttcttacactgaaactaagagg
cttctgccccttcagggcaagcagagagtcatcatgggagccatacatgatccatcattc
tctgaaaccattgatgggaatgaggtgctgcttaatgaagatctcttaggttcatttaaa
tcggggactggaagtattaagaaatggactgatttggaagatgcctttagaaatgaagat
gagttttttccatcccagataggaagaaaatccaaaagtgctttctaccaagtgaatgat
gattatttatttgctgctggtcagcctcgactgcacaaccacctgcaagagatagcaaaa
ttcatctcaactgatgaggataatccaaaagcaaatattttacagaacaactggagccat
cagagaagaatgaagagaaggagcacaaagcacaggagaagccagatgcttgatgaatcc
gatgactgggatgggttatattccacaatgtcgaaatcctttctttacaagctttggaaa
ggggatgtctcttccaagatgttaaaccctcgactgcagaaggcgatgaaagattatttg
agcaccaataagcatggggtgcggttcaaggggaaacgaaactccaaattgacaggagac
cagctattctgtgagctaaaagaaagggtgaatgtgaaaacaatagatggcaaggaagct
cctttctccactcttggatgggaaaagcacgttccccaaattccactgggcaaattgtat
acacatggctttgggagctgcgctgtcgttatgtctgctggtgcaatactgaattcctct
ctaggggatgaaatagattctcacgatgctgttctaagatttaattctgctccaacacgt
ggctatgaaaaagatgttggaaataaaacgaccatgcggatcattaactctcagattctc
accaatccaaaccaccactttgtcgacagctccttgtacaaagatgttatcttagtagcc
tgggaccctgccccctactctgcaaatttgaatgtgtggtataagaagccagactacaat
ctgttcactccctacgtacagcatcgcaggaagaatccaaaccaaccgttttacattctc
catccaaagtttatatggcagctctgggacatcattcaagagaacactaaagagaaaata
cagcccaaccctccttcttcaggttttattggtatcctcatcatgatgtccatgtgtaac
gaggtgcacgtgtacgaatacatcccttctgtccgacagaccgacctgtgtcactaccat
gaactctactacgatgcagcgtgtaccttaggggcctaccacccactgctctacgagaag
ctgctggtgcagaggatgaacaaaggtttgcaggatgatctgtatcggaaggggaaagtc
attttgccagggttcaaagctgtcaagtgccccaaaagaaataacttcccacacttgtag

DBGET integrated database retrieval system