KEGG   Columba livia (rock pigeon): 102088102Help
Entry
102088102         CDS       T02912                                 

Gene name
COMT
Definition
catechol-O-methyltransferase
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
clv  Columba livia (rock pigeon)
Pathway
Steroid hormone biosynthesis
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102088102 (COMT)
  Amino acid metabolism
   00350 Tyrosine metabolism
    102088102 (COMT)
Enzymes [BR:clv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     102088102 (COMT)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102088102 (COMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 263 aa AA seqDB search
MLESSSVLLFIVFVLIFVLLLFTVLIRKNAAAVALIWHEIIREKITNFIMNQSKEQRILD
FVLQNAVRGDPCSVVDTIDKYCSQKEWAMNVGNEKGIILDKTVEEVNPSVALELGTYCGY
SAVRIAQLLKPGARLLTVEFNPKFAAIAKQMIEFAGVHDKVTTIXGPSEEIIPQLKKKYE
VDTLDFVFLDHWKDRYTPDTILIQECNLLRKGSVLLADNVIVPGAPEFLNYIRNNPRFQC
TNYPSHLEYMKVKDAMEKAVFLG
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgctggagagctcttcagtccttttgttcattgtctttgtcctgatttttgttttgctg
ctcttcacggtgctcatcaggaaaaacgctgctgctgttgcccttatctggcatgaaata
atccgggaaaaaataaccaatttcatcatgaatcagagcaaagaacagaggattttagat
ttcgtgctgcagaatgcagtccgaggagacccctgtagcgtggtggacactatagataag
tactgctcccagaaagagtgggccatgaacgtgggcaatgagaaaggtataattctagac
aaaacagtggaagaggtcaatccatcagttgcactggagctgggaacatactgtggctac
tcagcagttaggattgctcagctgctgaagccaggagctcgtcttctcactgtggagttc
aacccaaaatttgctgctatagctaaacagatgattgagtttgctggagtacatgataag
gtaactacaatttaaggcccatcagaggagattatccctcagctgaagaaaaaatatgaa
gtggatactctggattttgtcttcctggatcactggaaagacagatacacaccagacacc
atcttaattcaggaatgcaacttgctgagaaagggctcagttcttctggctgacaacgtc
atcgtcccaggagctccagaattccttaactatatccgcaacaacccccgtttccaatgc
actaactacccatctcatctggaatatatgaaagtgaaggatgctatggaaaaggctgtg
tttttgggataa

DBGET integrated database retrieval system