KEGG   Columba livia (rock pigeon): 102088179Help
Entry
102088179         CDS       T02912                                 

Gene name
MAOB
Definition
monoamine oxidase B
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102088179 (MAOB)
   00330 Arginine and proline metabolism
    102088179 (MAOB)
   00340 Histidine metabolism
    102088179 (MAOB)
   00350 Tyrosine metabolism
    102088179 (MAOB)
   00360 Phenylalanine metabolism
    102088179 (MAOB)
   00380 Tryptophan metabolism
    102088179 (MAOB)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102088179 (MAOB)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102088179 (MAOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 521 aa AA seqDB search
MAEKYDVIVVGGGISGLSAAKLLTEWGLNVVLLEANDRVGGRTFTIRNKHVKYVDLGGAY
VGPTQNRLLRLSKELGIETYKVNEVEHLIHHVKGKSYPFKGPFPPMWNPLAYLDYNNLWR
TMDEMGKEIPSEAPWKAPHAEEWDKMTMKDFIDKTCWTNAAKSFATLFVNVDVTSEPHEV
SALWFLWYVKQCGGTTRIFSTTNGGQERKFVGGSGQISEKIMERLGGRVKLRKPVVRIDQ
SSERVVVGTLDNELYEAKYVISAIPPALCLKIHFNPPLPPARNQLINRIPMGSVIKCIVY
YKETFWRKKGYCGTMIIEDEDAAISLTLDDTKPDGSFPAIIGFILARKCRRLTGLTKEER
KTRLCELYAKVLGSEEALHPVHYEEKNWCEEQYSGGCYTAYFPPGIMTQYGRIIREPVGR
IYFAGTETATEWSGYMEGAIQAGERAAREVLFAMRKIPDSEIWKPEPESIDVPALPITTT
FWERNLPSVPGLLKLIGFSTFFTSVAVAGLFAYKKGLLARN
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaaatacgacgtgatcgtggtcgggggcggcatctcaggtctctcagcagcc
aaactgctgactgagtggggcttgaatgtggtgttgcttgaggccaatgacagagttggt
ggaagaactttcaccataaggaataagcatgttaaatatgtggaccttggaggagcttat
gtggggccaacacaaaatcgtctcttgcggttatctaaggagttaggaatagagacgtat
aaagtgaatgaagttgagcacctgatacaccatgtcaagggtaagtcttacccttttaaa
ggtccattccctcctatgtggaatccattggcctacctggactacaacaacctctggagg
accatggatgaaatgggaaaggagattcccagtgaagccccatggaaggctccacatgca
gaagaatgggacaaaatgactatgaaagatttcatagataaaacttgctggacaaatgct
gccaagagtttcgcaaccctgtttgtgaatgtggatgtcacttctgaaccccatgaggtc
tctgccctttggtttttgtggtacgtgaagcagtgtgggggcacaacaaggatattctca
acaaccaatggagggcaggagaggaagtttgttggaggctctggccagatcagtgagaaa
ataatggagcgcctgggaggccgggtgaagctgaggaagccagttgtgcgcatcgaccag
tcgagtgaacgtgttgtagtgggaaccttagataatgagttatatgaggccaaatatgtg
atcagtgccattcccccagctctttgtttgaagattcatttcaacccacctttgcctcca
gcgagaaaccagctcatcaaccgaatccccatgggctcagtcatcaagtgcattgtgtac
tataaggaaactttttggaggaagaaggggtattgtggtaccatgatcattgaagatgag
gatgctgctattagtttaacacttgacgatactaagcctgatggcagctttcctgccata
ataggcttcattcttgctcgaaaatgtagaagactgacaggtctcacaaaagaagaaagg
aagacgaggctatgtgagctctatgcaaaagttctcggatcagaggaagctttacatcca
gtgcattatgaagagaagaactggtgtgaagagcagtattctgggggttgctacacagcc
tacttcccaccaggcataatgactcagtatggaaggattattcgggagcctgtcggcagg
atctattttgctggcacagagacagccacggagtggagcgggtacatggagggggctata
caggctggagaaagagcagccagagaggtactgttcgctatgaggaaaatcccagacagt
gaaatttggaagccagaacctgaatcaattgatgttccagctttgcccatcactacaacc
ttctgggaaaggaacttgccatctgtgccaggattgctaaagctgattggattttccact
ttctttacttctgtggctgtggcaggattatttgcctacaaaaagggacttctggctcga
aactga

DBGET integrated database retrieval system