KEGG   Columba livia (rock pigeon): 102088254Help
Entry
102088254         CDS       T02912                                 

Gene name
C1GALT1
Definition
core 1 synthase, glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase, 1
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
clv  Columba livia (rock pigeon)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Mucin type O-glycan biosynthesis [PATH:clv00512]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 366 aa AA seqDB search
MASSKSLMNLLTFTFGSAIGFFVCYLLFSIILEEQVKIQPHILHNDPHGQHSADIDNNQL
QGQMNFNADSGQHKDENKNIAEGLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKIL
FMSSEENKDFPTVGLETKEGRDQLYWKTIKAFQYVYDNYFDDADWFMKADDDTYVVLDNL
RWLLSKYSPEQPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVNAFKTNKCSHSSSIE
DLALGKCMEIVNVEAGDSRDTNGRETFHPFVPEHHLVRGYLPKTFWYWNYNYYPAVEGPG
CCSDLAVSFHYVDSITMYHLEYLIYHLRPYGYLYRYNPDLAKNPEEQSKNEALEDNQKLE
QKISEN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcctcttctaagtctttgatgaaccttctaaccttcacttttggatcagcaatagga
ttttttgtatgctatcttctgttcagcattatactagaagaacaggttaagatccagcct
catatccttcacaatgatccgcatggtcaacactcagcagatatcgataacaatcagctg
caaggacaaatgaatttcaatgcagactctggacagcataaagatgagaataaaaatatt
gcagagggactgtatcagaaggtgagaatactctgttgggttatgacgggacctcaaaat
ctagaaaagaaagccaagcatgttaaggccacttgggcccagcgttgtaataaaatactt
tttatgagctctgaggagaacaaagacttcccaactgtgggcctagaaaccaaagaaggc
agggaccaactgtactggaagactattaaagcttttcaatatgtatatgacaattatttt
gatgatgctgattggtttatgaaagcagatgatgacacatatgttgtcttggacaatttg
agatggcttctttcaaaatacagtcctgaacaaccaatatactttggaagaaggtttaag
ccttatgtaaaacagggctacatgagcggaggagcgggatatgttctaagcaaagaagct
ctgaagagatttgttaatgcatttaaaacaaacaaatgctctcacagttcctctattgaa
gacctagcactgggaaaatgcatggagatcgttaatgtggaagcaggagattctagagat
acaaatggtagagaaacctttcatccatttgttccagaacatcacttagtcagaggatac
ctaccaaaaacattctggtactggaattataattattatcctgctgtagagggtcctgga
tgctgctctgatctagcagtttcattccactatgttgactccattactatgtatcatttg
gaatatttgatttatcatctccgtccatatggatatttgtatcgatacaatcctgatttg
gcaaagaatccagaagagcagagcaaaaatgaagcactggaggataatcaaaagctagag
caaaaaatatctgagaattaa

DBGET integrated database retrieval system