KEGG   Columba livia (rock pigeon): 102088495Help
Entry
102088495         CDS       T02912                                 

Gene name
MAOA
Definition
monoamine oxidase A
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102088495 (MAOA)
   00330 Arginine and proline metabolism
    102088495 (MAOA)
   00340 Histidine metabolism
    102088495 (MAOA)
   00350 Tyrosine metabolism
    102088495 (MAOA)
   00360 Phenylalanine metabolism
    102088495 (MAOA)
   00380 Tryptophan metabolism
    102088495 (MAOA)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102088495 (MAOA)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102088495 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 446 aa AA seqDB search
MKVCSIVFQLLMFLCVFXGKSRYFTGISPSTWNPLVYLDFNNLWRTMDKLGEEIPLNAPW
DAPHAEEWDKMTMKELINKICWTKAAKDFATFFVNVNVTSEPHEVSALWFLWYLRQCGGT
SRIFSVTNGGQERKFKGGSGQISEKIMQRLKGSVKLERPVVHIDQTGDNVIVETLNHELY
ECKYVISAIPPILMTKIHYKPELPSKRNQLIQRLPMGCVIKCMMYYREAFWERKGYCGSF
VIEDEESPIGITLDDTKPDGSFPAIMGFILTRKAVKLAHLSKEERKKKICEAYARAMGME
EALHPVHYEEKNWSMEQYSGGCYTSYFPPGVMYSYGRIIRQPIDRIYFAGTETATQWSGY
MEGAVQAGERAAREILHSMGRISKTEIWMPEPESKDVPARPFTTSFWERNLPSVPGLLCL
LSSTMCFTSVAAAGLFAYKKGLLVQN
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtatgctccattgtgtttcagttgcttatgttcttatgtgtattttagggaaag
tcacgctatttcacaggtatttccccctcaacatggaatcccttagtttatctggatttc
aataacttgtggaggaccatggacaagctgggagaagagattcccctcaatgcaccatgg
gatgctccacatgctgaagaatgggacaaaatgaccatgaaagagctgataaataagatt
tgctggaccaaagctgctaaagattttgccaccttcttcgtgaatgtcaacgtcacgtct
gagcctcatgaagtctccgctctctggttcctgtggtacctgaggcagtgtgggggcaca
tccaggattttctctgtcaccaatgggggccaggagaggaagtttaaagggggttctggt
cagatatcagagaaaataatgcaacgcctcaaaggcagcgttaaactggagagacctgtg
gtccatattgatcagacaggtgataatgtcattgtggagactctaaaccatgagttatat
gagtgcaagtatgtgatcagtgctatcccaccaatcctgatgacaaagattcattacaaa
ccagaactgccatcaaaaagaaaccagttaattcagcgtttgcctatggggtgtgtcata
aaatgcatgatgtactacagggaagccttctgggagaggaagggttattgtggttccttt
gttattgaggatgaagagtctccaattggaataaccctagatgacacaaaacctgatgga
tctttccctgccattatgggtttcatccttacaagaaaagctgttaaactggctcatctc
agtaaggaggagaggaagaagaagatctgtgaggcatatgccagggcaatggggatggaa
gaggctttacaccctgtgcattatgaagaaaagaactggagcatggagcaatattcaggg
ggttgttacacatcctacttcccaccaggtgtaatgtattcttatggaaggatcattcgc
cagcccattgacagaatctactttgctggcacggagacagctacccaatggagtggatac
atggagggggctgtacaggcaggagagagagcagccagagagatattacacagtatgggc
aggatctcaaaaactgaaatttggatgccagagccagagtcgaaggatgtcccagcccga
ccgttcaccaccagcttctgggagaggaacctgccgtccgtgccaggactgctgtgcctg
cttagctcgaccatgtgtttcacctctgtggctgctgcagggctgtttgcctataaaaag
ggactactggttcaaaattag

DBGET integrated database retrieval system