KEGG   Columba livia (rock pigeon): 102088495Help
Entry
102088495         CDS       T02912                                 

Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
clv  Columba livia (rock pigeon)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102088495
   00330 Arginine and proline metabolism
    102088495
   00340 Histidine metabolism
    102088495
   00350 Tyrosine metabolism
    102088495
   00360 Phenylalanine metabolism
    102088495
   00380 Tryptophan metabolism
    102088495
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    102088495
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     102088495
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 534 aa AA seqDB search
MPGMSLVCGLRHHSPVLDLTLHGVLTGHGLSAAKLLSESGVSVVVLEARNRVGGRTFTIR
NDQVNYVDVGGSYVGPTQNRILRLAKELGIETYKVNVKGHMIHYKGGKSRYFTGISPSTW
NPLVYLDFNNLWRTMDKLGEEIPLNAPWDAPHAEEWDKMTMKELINKICWTKAAKDFATF
FVNVNVTSEPHEVSALWFLWYLRQCGGTSRIFSVTNGGQERKFKGGSGQISEKIMQRLKG
SVKLERPVVHIDQTGDNVIVETLNHELYECKYVISAIPPILMTKIHYKPELPSKRNQLIQ
RLPMGCVIKCMMYYREAFWERKGYCGSFVIEDEESPIGITLDDTKPDGSFPAIMGFILTR
KAVKLAHLSKEERKKKICEAYARAMGMEEALHPVHYEEKNWSMEQYSGGCYTSYFPPGVM
YSYGRIIRQPIDRIYFAGTETATQWSGYMEGAVQAGERAAREILHSMGRISKTEIWMPEP
ESKDVPARPFTTSFWERNLPSVPGLLCLLSSTMCFTSVAAAGLFAYKKGLLVQN
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgcctggcatgagtcttgtctgtggcctacgacatcacagcccagtactggatttgacc
ctgcatggcgtgctcacaggtcatggtttgtctgctgccaaattactgtctgagtctggg
gtcagcgtggtggttcttgaggcccggaacagagttggaggaaggacattcactatcagg
aacgatcaagtcaactacgtagatgttggtggatcgtatgtgggacctacccaaaaccgg
attctccgattggcaaaagagctgggtattgagacctataaagttaatgtcaagggccat
atgatccattataaggggggaaagtcacgctatttcacaggtatttccccctcaacatgg
aatcccttagtttatctggatttcaataacttgtggaggaccatggacaagctgggagaa
gagattcccctcaatgcaccatgggatgctccacatgctgaagaatgggacaaaatgacc
atgaaagagctgataaataagatttgctggaccaaagctgctaaagattttgccaccttc
ttcgtgaatgtcaacgtcacgtctgagcctcatgaagtctccgctctctggttcctgtgg
tacctgaggcagtgtgggggcacatccaggattttctctgtcaccaatgggggccaggag
aggaagtttaaagggggttctggtcagatatcagagaaaataatgcaacgcctcaaaggc
agcgttaaactggagagacctgtggtccatattgatcagacaggtgataatgtcattgtg
gagactctaaaccatgagttatatgagtgcaagtatgtgatcagtgctatcccaccaatc
ctgatgacaaagattcattacaaaccagaactgccatcaaaaagaaaccagttaattcag
cgtttgcctatggggtgtgtcataaaatgcatgatgtactacagggaagccttctgggag
aggaagggttattgtggttcctttgttattgaggatgaagagtctccaattggaataacc
ctagatgacacaaaacctgatggatctttccctgccattatgggtttcatccttacaaga
aaagctgttaaactggctcatctcagtaaggaggagaggaagaagaagatctgtgaggca
tatgccagggcaatggggatggaagaggctttacaccctgtgcattatgaagaaaagaac
tggagcatggagcaatattcagggggttgttacacatcctacttcccaccaggtgtaatg
tattcttatggaaggatcattcgccagcccattgacagaatctactttgctggcacggag
acagctacccaatggagtggatacatggagggggctgtacaggcaggagagagagcagcc
agagagatattacacagtatgggcaggatctcaaaaactgaaatttggatgccagagcca
gagtcgaaggatgtcccagcccgaccgttcaccaccagcttctgggagaggaacctgccg
tccgtgccaggactgctgtgcctgcttagctcgaccatgtgtttcacctctgtggctgct
gcagggctgtttgcctataaaaagggactactggttcaaaattag

DBGET integrated database retrieval system