KEGG   Columba livia (rock pigeon): 102089178Help
Entry
102089178         CDS       T02912                                 

Gene name
GPT2
Definition
(RefSeq) alanine aminotransferase 2
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00220  Arginine biosynthesis
clv00250  Alanine, aspartate and glutamate metabolism
clv01100  Metabolic pathways
clv01200  Carbon metabolism
clv01210  2-Oxocarboxylic acid metabolism
clv01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102089178 (GPT2)
   00220 Arginine biosynthesis
    102089178 (GPT2)
Enzymes [BR:clv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     102089178 (GPT2)
Amino acid related enzymes [BR:clv01007]
 Aminotransferase (transaminase)
  Class I
   102089178 (GPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 102089178
NCBI-ProteinID: XP_005504737
UniProt: A0A2I0M2K8
Position
Unknown
AA seq 423 aa AA seqDB search
MGQRPITFLRQVVALCTYPNLLDSPSFPEDAKKRARRILQDCGGNSLGSYSASQGINCIR
EDVAAYIERRDGGVPADPDNIYLTTGASDGITTILKILVSGGGKSRTGVMIPIPQYPLYS
AVISELNAIQVNYYLDEENCWALYVNELRRSLNEAKAYCNPKVLCIINPGNPTGQVQSRK
CIEDVIHFAWEEKLFLLADEVYQDNVYSEGCQFHSFKKILYEMGPEYYNNVELASFHSTS
KGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRICPPVSGQAAMDIVVNPPVPGEESYS
QFIKEKESVLNNLAKKAKLTEDMFNTVPGINCNPLQGALYAFPRIFIPSKAIEEAKAHKM
APDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTVLPPVEKLKILLEKLKDFHIKFLE
KYA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagaccaatcaccttcctccgtcaggtagtggccctgtgcacatacccaaac
ctgttggacagcccaagttttccagaagatgccaaaaagcgagccagacggatcttgcag
gactgtggaggaaacagcctgggttcttacagtgccagccaagggataaactgcatccgt
gaagatgttgccgcatacattgaaagaagagatggaggggttcctgcagacccagataac
atctatcttaccacaggggcaagtgatggaattactacaatattaaagatcctggtctca
ggaggtgggaaatcccgaacaggagtgatgatccctataccacaatatcctttatattca
gcagtcatatctgaactgaatgctattcaggtgaactactatttggatgaagaaaattgc
tgggctctgtatgtgaacgaacttcgccgttccttgaatgaagcgaaggcatattgcaat
cccaaagtgctctgcatcatcaaccctggaaatcccacagggcaggtgcaaagcagaaag
tgcattgaagatgtgatacactttgcttgggaagagaaactttttcttctggctgatgag
gtttaccaggacaatgtgtactctgaaggatgccagtttcattccttcaaaaagattctg
tatgagatgggacccgagtactataacaatgttgagctggcctcttttcactccacctct
aagggatacatgggcgaatgtggctacagaggaggttacatggaggtcattaacttgcac
ccagaaattaaaggacagcttgttaagctgctttccgttcgcatttgtcctcccgtctca
ggacaagcagcaatggatattgtggtgaatcctccagtacctggagaagaatcttattca
cagttcataaaggagaaggagtctgttctcaacaaccttgccaaaaaagccaagctgaca
gaagacatgtttaacacggtgccggggattaactgcaatcccctccaaggagccttgtac
gcgttcccacgcatctttattccttccaaagccattgaggaagcaaaggctcacaaaatg
gcacctgatatgttctattgcatgaaacttctggaagagactggaatatgtgtcgtacct
ggaagtggatttggccaaagagaaggaacctaccatttcagaatgaccgttcttccccca
gtagagaagctgaagatcctactggagaaactgaaagacttccacataaagtttcttgaa
aaatatgcatga

DBGET integrated database retrieval system