KEGG   Columba livia (rock pigeon): 102089270Help
Entry
102089270         CDS       T02912                                 

Gene name
UGT2A1
Definition
(RefSeq) UDP-glucuronosyltransferase 2A2
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
clv  Columba livia (rock pigeon)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    102089270 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    102089270 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    102089270 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    102089270 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    102089270 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102089270 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    102089270 (UGT2A1)
   00983 Drug metabolism - other enzymes
    102089270 (UGT2A1)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     102089270 (UGT2A1)
Glycosyltransferases [BR:clv01003]
 Others
  Hydrophobic molecule
   102089270 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 532 aa AA seqDB search
MATKATSSQKYLQLLLLQVTLLGPVSCGKVLVWPTEGSHWLNVKIIIQELIHRGHNVTIL
VSNASLFIKPAEATEKFEVYNVPFETDTVENLIRHTVALWLDNRPTTLTFWQFYKELGKL
SKHWNQMNRLMCDAVVTNQELMAHLQESGYDLVLSDPVTPCGELVALKLAIPFIYSLRFS
PAFTLERHCGKIPTPPSYTPAALSELTDSMSFSQRIKNILSYHLQDYVFQSYWGEWDVYY
SKVLGRTTTLCETMGKAEIWLIRTYWDFEFPRPFLPNFEFVGGLHCQPAKPLPKEMEEFV
QSSGEHGIVVFSLGSMVNNLTDEKSNIIARALSQLPQKVLWRYKGKKPEALGSNTRIYDW
IPQNDLLGHPLAKAFLTHGGTNGIYEAIYHGIPMVGIPMFADQHDNIAHMRAKGAAVELD
FNRLTTQDLVNALNTVINNSTYKENALRLSKIHHDQPIKPLDRAVFWVEFVMRHKGAKHL
RPAAHHLTWYQYHCLDVLAFLLTCAAIAVFILVKCCLFCCRRCGRIAKRKKD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccacaaaagccaccagctctcagaaatacctccagctgctccttcttcaggtcact
ctcctagggcctgtctcctgtgggaaggtattggtctggccaacagaaggtagtcactgg
ctgaacgtgaagataattatacaggagctcatccaccgcgggcacaacgtcaccatcctg
gtgtccaatgcttccctcttcattaaacctgctgaggccacagagaagtttgaggtctat
aacgtgccctttgagacagacaccgttgagaacttgatcaggcatacagtggcactgtgg
ctggataacaggccaaccaccttgaccttctggcagttttacaaggagctgggaaaacta
tcaaaacactggaaccagatgaacaggctgatgtgcgatgcagtggtaaccaaccaagag
ctgatggcccatctgcaagagtctggctatgacctggtgctgtcagaccccgtgacccct
tgtggggaacttgtggctctcaagttggccatccccttcatctactcactgcgcttctcc
ccagccttcaccctggagaggcactgtgggaagatccccaccccaccgtcctacacgcct
gcagccctgtctgagctcactgacagcatgtccttcagccagagaataaaaaacatcttg
tcttatcatctgcaagactacgttttccagagctactggggagaatgggatgtgtactat
agcaaggtcctaggaaggaccacaaccctgtgtgagacgatggggaaagcagagatctgg
ttaatcagaacatactgggattttgaatttccacgccctttcctgcccaactttgagttc
gttggaggacttcattgccagcctgcaaagccgttaccaaaggaaatggaagaattcgtt
cagagctcaggggaacacggcattgtggtattctctcttgggtcgatggtcaacaacctc
actgatgaaaaaagtaacatcattgccagagcactcagccagcttccacaaaaggtcctc
tggcggtacaaagggaaaaagccagaagctttggggtccaataccaggatttatgactgg
ataccccaaaatgacctgcttggccaccccttggcaaaggccttccttactcacggtggg
accaacgggatctacgaagcgatctaccatgggatacccatggttgggattcccatgttt
gctgaccagcatgacaacatcgctcacatgagggcaaagggagctgcagtggagctggat
ttcaacaggctgacaacgcaggaccttgtcaatgcactgaacacagtcatcaacaattcc
acctataaggaaaatgctctaaggctatccaagatacaccatgatcagccaatcaagcct
ctggacagagccgtcttctgggttgaatttgtcatgcgtcacaaaggagcaaagcacttg
agaccagctgcgcaccatctcacctggtaccagtaccactgcctggatgttctggcgttc
ttgctcacctgtgcagccattgctgtcttcattcttgtcaaatgctgcttattttgctgt
aggagatgtggcaggatagcgaagaggaagaaagactag

DBGET integrated database retrieval system