KEGG   Columba livia (rock pigeon): 102089813Help
Entry
102089813         CDS       T02912                                 

Gene name
POMT2
Definition
(RefSeq) protein-O-mannosyltransferase 2
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
clv  Columba livia (rock pigeon)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    102089813 (POMT2)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     102089813 (POMT2)
Glycosyltransferases [BR:clv01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   102089813 (POMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 683 aa AA seqDB search
MVPRGDRGSGSWDETHFGKMGSYYINRTFFFDVHPPLGKMLIGLAGYLSGYDGTFPFQKP
GDRYEQHNYMGMRGFCAFLGSCLVPFAYLTVLELSKSLPAALLTAFILIFDTGCITLSQY
ILLDPILMFFLMGAVLSMVKCNSCADRPFSASWWFWLSLTGVNLAGAMGVKFVGLFVVLF
VGLNTISDLWGLLGDLSLSLVVFGKHLLARVLCLILLPLALYMTVFAVHFTVLNKSGPGD
GFFSSAFQSQLIGNNLHNVSIPEHLAYGSVVTMKNLRMAGGYLHSHWHLYPEGVGARQQQ
VTAYLHKDLNNLWIIKKRYSDTDLSDPSSPVEFVRHGDIIRLEHKETSRNLHSHRHEAPL
TKKHFQVTGYGINGTGDSNDFWRIEVMSRKAEKLIKVLRSQVQLTHVATGCILGSSGKTL
PKWGWEQVEVTCTPYLKKSPNSLWNFEDHINPKLPNISLDVLKPSFAEILLESHMVMIRH
NCLLIHIGLKPKDNEVTSKPWHWPINYQGLRFSGVNETDYRVYLLGNPVIWWLNLVTIGL
YLLIAVSTAVALKRGVQLTSELRELSRVVLRGGAQMMLGWLLHYLPFFMMGRVLYFHHYF
PAMLFSSMLTGITWDTLLKFCAGLLSSSTTARKVYGAGFLALFLLIVYSFYLFHPLSYGM
IGPMASDPSSPMAGLRWMDSWEF
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atggtgccgagaggggatcgggggtcggggagttgggatgaaactcattttgggaagatg
ggaagttactacattaatcggaccttcttctttgatgtccacccccctttggggaagatg
ctgattggacttgctggctaccttagtggatatgatggtacatttcctttccaaaagccg
ggggacagatatgaacagcataactacatgggaatgagagggttctgtgcattccttggc
tcctgcctggttccctttgcctacctcacagtgttggaactgtcaaagtcactgccggca
gccttactcacagctttcatccttatttttgatacgggctgtattactttgtcgcagtat
attctgctggaccccattctgatgttcttcctcatgggagctgttctgagtatggtgaaa
tgtaacagctgtgcggataggccattctctgcttcctggtggttctggctgagtctgact
ggcgtgaaccttgctggagcaatgggagtaaagtttgttggcctttttgtagtcctcttt
gttggcctgaatacaatctctgacctatggggcttgctgggggacctcagcctgtcactg
gtcgtgtttgggaagcatttactggctcgtgtactctgcctcatcctgctcccgcttgcc
ctctacatgactgtgtttgctgttcattttacagtattaaataaaagtggtcctggggat
ggtttcttcagttcagcgtttcagtcccaactgatcgggaacaatcttcataacgtctcc
attccagagcacttggcgtacggatctgtggtcacaatgaagaaccttcggatggcaggg
ggataccttcactcccactggcatctctacccggagggcgttggagctcgccagcagcag
gtcactgcctacttacataaagatttgaataacctctggattataaagaaacgttattca
gatacagatctgtcagacccctcaagccctgtggagtttgtgaggcatggagatattatt
cgtctggaacataaagaaacttctagaaaccttcacagtcaccgacatgaggctccactg
acaaagaagcattttcaggttactggctatggaataaatggaacaggagactccaatgat
ttctggcggattgaagtgatgagcagaaaggctgagaagctcatcaaagtcctacggagt
caggtccagctaacccatgtggccacggggtgtatattgggctcttctggaaagactctg
ccaaaatggggttgggagcaagtggaagtcacctgcacaccatacctgaagaagagtccc
aattccctctggaactttgaagatcatatcaaccctaagttgcccaatatcagcctggat
gttttgaagccttcttttgcagaaattctgctagaatcccacatggttatgatccggcat
aactgcctgctcattcacattggcctcaaaccaaaggacaatgaagttacatccaaacct
tggcactggcccatcaactaccagggcctgcgtttttctggtgtcaatgagaccgattat
cgggtttatttgctgggaaacccggtgatttggtggctaaatctggtaactattgggtta
tatcttctgatagcagtttccactgcagtggccttgaagagaggtgtccaactgacttct
gaactcagagaactgtccagagttgtgctacgtggtggagcgcagatgatgctgggctgg
ctccttcattacctccctttttttatgatgggccgagttctctactttcaccactacttt
cctgccatgcttttttctagcatgttgacaggaatcacctgggacacactactaaagttc
tgcgctgggcttttatcatccagtactacagctagaaaagtatatggagcggggttcctg
gcactgttcttgctcattgtgtacagcttctacctcttccatcctctgtcctacgggatg
ataggacccatggcctccgatcctagcagccccatggcagggctccggtggatggactcc
tgggagttctag

DBGET integrated database retrieval system