KEGG   Columba livia (rock pigeon): 102090139Help
Entry
102090139         CDS       T02912                                 

Gene name
GBE1
Definition
(RefSeq) glucan (1,4-alpha-), branching enzyme 1
  KO
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
clv  Columba livia (rock pigeon)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102090139 (GBE1)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     102090139 (GBE1)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102090139 (GBE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 704 aa AA seqDB search
MENMSQTAQLLLANFYIRGLGHFKSYWDKYSLFYNRLKNIEENEGGLDKFTKSYKTFGVN
QFVDGGIYCKEWAPGAEAVFLTGDFNGWNPFSHPYKKMEYGKWELFIPPGQDGYPPVPHG
SKLKVVIRAQNGELLYRISPWARYVVRDEDKVNYDWVHWNPPLSYIRKHPSPKRLKSLRI
YESHVGIASPEGKVASYKNFTYNVLPRVKDLGYNCVQLMAIMEHAYYASFGYQVTSFFAA
SSRYGTPDDLKEMIDVAHSMGITVLLDVVHSHASKNSEDGLNKFDGTDSCFFHSGPRGNH
QLWDSRLFDYANWEVLRFLLSNLRMWIEEYRFDGFRFDGVTSMLYHHHGIGTGFSGDYNE
YFGLHVDEDALCYLMLANHMIKFLHPECITIAEDVSGMPALCRPVAEGGGGFDYRLAMAI
PDKWIQIIKELKDEDWNMGNIVHTLTNRRHEEKYIAYAESHDQALVGDKTLAFRLMDAEM
YTNMSVLSPLTPVIDRGIQLHKMIRLITHALGGESYLNFMGNEFGHPEWLDFPRKGNNES
YHYARRQFNLTEDHLLRYRFLNAFDRDMNKLEERFGWLASPPAYVSEKHESNKVIAFERA
GLIFIFNFHPYQSYVDYRVGIEIPGKYKILLDSDAAEYGGHQRLDHSTEYFSEEYPHNYR
PNSLMQSNSQTNFSQQPRRCHKYCIEVYIPSRVAIVLYNVDIQK
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatgtcacaaacagcccagctgttactagcaaatttttacattagaggttta
gggcatttcaagtcctactgggataagtattctctgttttataaccgcttgaagaacatt
gaggaaaatgaaggaggccttgataaatttacaaaaagttacaaaacctttggagttaac
caatttgtggatggtggaatatattgcaaagagtgggcaccgggagcagaagcagtgttt
ctcacaggtgacttcaatggctggaatccattttctcatccatataagaagatggagtat
gggaagtgggagttgttcattccacctggacaagatggttatcctcctgtgccccatgga
tcaaagctaaaggtggtgattcgtgctcaaaacggcgaactcctctatcgtatttcacct
tgggcaagatatgtagtccgtgatgaagacaaagtgaattacgattgggtacattggaat
ccaccactgtcatatatacgtaagcatccttcacccaagagattaaaaagcctaagaatc
tatgaatctcatgtagggattgcttccccagaaggaaaagtagcttcttataaaaacttc
acatacaatgtactacctagagtaaaggatcttggatataactgtgtccagctgatggct
attatggaacatgcatactatgccagttttggttatcaggtcacaagcttctttgcagca
tcaagccgttatggaactccagatgacctgaaagaaatgattgacgttgctcactcaatg
ggaatcactgttctgctggatgttgtgcatagccatgcctcaaaaaactcggaagatggt
ctcaacaaatttgatggtacagattcttgtttcttccattctggtcctagaggaaatcat
cagctctgggacagcaggctctttgactatgcgaactgggaagttttgagattccttctg
tctaatttgagaatgtggatcgaagaataccgctttgatggattccgatttgatggtgtt
acatctatgttgtatcaccatcatgggattggcacaggattcagtggagattacaatgaa
tattttggtctacatgtggatgaagatgctttgtgttatctaatgctggccaaccacatg
attaagtttttgcatccggaatgcataaccatagcagaggatgtttctggaatgccagct
ctttgtcgtcctgttgcagagggaggagggggttttgattatcgactagccatggctatt
ccagataagtggatacagataattaaggagctgaaagatgaagactggaatatgggcaat
attgtgcatacattaacaaatagacggcatgaagaaaaatacattgcatatgcggagagt
catgaccaggcacttgttggtgataagacattggcgtttcgactgatggatgcagagatg
tatacaaacatgagtgtgctctcacctcttactccagttattgatcgtggaatacagctt
cataaaatgatacgtctcattactcatgcacttggaggagagagctatctgaacttcatg
ggtaatgaatttggacatccagaatggcttgacttccccagaaaagggaataatgagagc
taccactatgccagaagacagtttaatcttactgaggatcatcttcttcgctataggttc
ctaaatgcatttgatagagacatgaataaattggaagaaagatttggctggcttgcatct
cccccggcctatgtgagtgaaaagcatgaatccaataaagtcatagcgtttgagagagca
ggtctcatttttattttcaacttccatccgtatcaaagttacgtggactacagagtgggt
attgaaattccaggaaagtataaaatccttctggattctgatgctgcagaatatggaggg
catcaaaggctggaccacagtacagagtacttctctgaagaatatcctcacaattatcga
cctaattcacttatgcagtccaattcacagaccaacttcagccaacagcccagacgatgc
cacaagtactgcatagaggtgtacattccaagcagagtggctattgtgctttacaatgtg
gatatccaaaaatga

DBGET integrated database retrieval system