KEGG   Columba livia (rock pigeon): 102090216Help
Entry
102090216         CDS       T02912                                 

Gene name
ABHD12B
Definition
(RefSeq) protein ABHD12B
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
clv  Columba livia (rock pigeon)
Brite
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     102090216 (ABHD12B)
Peptidases [BR:clv01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   102090216 (ABHD12B)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   102090216 (ABHD12B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 381 aa AA seqDB search
MAEPNGLWGTGSWPLVSRWGCSNPSPSPGAKHNPGVGNQSQSQGETTCSLRPLSWLSWCP
RLRTLLLDLLLIYLSVPFLIRLFPVLLTKFVFLNFLSFPYFVDLRRPELLLNNTVSLYLD
TEPGVTVGIWHTVPGSRGAEAQGKDQRWYEEALGDAHPVIIYLHGNGGSRAASHRIQFLK
TMGAADFHVLALDYRGYGDSSGHPTESGFTTDVLALYDWAKARSGNSSILFWGHSLGTGI
ATNAARKLQEERGVQVDAVVLESPYTNIRDAAANIPLTKIYRQFPGFEYLILDSLALGNM
FFRSDENVKVLACPLLILHAEDDAVLPPHLGHKLFEVAHSAYKDKTKVKFINFPKKLGLG
HDYISFNPELPALVKDFLNMK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggcagagccgaatgggctgtggggaaccggatcgtggcctctcgtgtcacggtggggc
tgttccaacccatccccatccccaggagccaaacacaaccccggtgtggggaaccagtcc
cagtctcagggggagacaacctgcagcctcagacctttgagctggctgtcctggtgtccc
cggctgcgtaccctcctcctggacctgctcctcatctacctctccgtgcccttcctcatc
cgcctcttccccgtcctgctcaccaaattcgtcttcctgaacttcttgtcattcccgtac
tttgtggaccttcgtcggccggagctgctgctgaacaacaccgtcagcctgtaccttgac
accgagccgggcgtcaccgtcggcatctggcacacggtgccgggcagcagaggggccgag
gcgcagggcaaggaccagcgctggtatgaggaggcacttggcgatgctcatcctgtgatc
atctacctgcacggcaacggggggagcagggctgccagccaccgcatccagttcctgaag
accatgggggctgctgacttccacgtcctggctcttgactacagaggctatggggactcc
agcggacaccccacggagagcggcttcaccacggacgtcctggcactctacgactgggcc
aaagcgcggagcgggaacagcagcatcctcttctggggacactccctggggacagggatt
gccaccaatgcggcaagaaaactgcaggaggagcgaggggtccaggttgatgccgtggtc
ctggagtcgccctacaccaacatccgtgatgcggccgccaacatccccctcaccaagatc
taccgccagttcccaggtttcgagtatctcatcttggactcgctagccctgggcaacatg
ttcttccgcagcgacgagaacgtgaaggtgctggcctgcccgctcctcatcctgcacgcc
gaagatgatgctgtgctgcctccgcacctgggccacaagctcttcgaggtggcacacagc
gcctacaaggacaaaaccaaggtgaagttcattaacttccccaaaaagctgggcctgggc
catgactacatctcgttcaacccggagctgcccgccctggttaaagacttcttaaacatg
aagtga

DBGET integrated database retrieval system